mariadb-client-10.6.15-150400.3.29.3<>,e p9|I{ qz+<`Q7zHU ihfP{\nچGsf0MfUfׄƔnGa)U aVaIBԖ,Lz {~ n;b$S7RJ/UA>L%(wZoNpVL2)Lr#gZ!>ުt3hrzmnEo_659j쩇;:&;0-r2>FF4?F$d ' :tx 17>!@! ! ! H!  i!  ! l! !  ! d & `&j&(89:=4B4F4G4!H5T!I5!X5Y6Z6`[6d\6l!]6!^8b9Jc9d:ue:zf:}l:u:!v;wB!xC!yCzEEEEF Cmariadb-client10.6.15150400.3.29.3Client for MariaDBThis package contains the standard clients for MariaDB.e h04-ch2aSUSE Linux Enterprise 15SUSE LLC SUSE-GPL-2.0-with-FLOSS-exceptionhttps://www.suse.com/Productivity/Databases/Clientshttps://www.mariadb.orglinuxx86_64/usr/sbin/sysusers2shadow mysql-user.conf <<"EOF" || [ -f /.buildenv ] u mysql 60 "MySQL database admin" /var/lib/mysql EOF @XPBc9zlAA큤e e e e e e e e e e e e e e e e e e e e e e e e e e dEdEdEdEdEdEdEff2618c4242f48e7a984cc0c95bbac507a4732f043e21f140a95cc87c26a093ac4508cdc215487448e6081aef3ebb73246b3ed70a4b65edb7722256df8c96590a93e8fa32abd2596ad60d11fe551345c7682e756ce5c5439d8a9f5166c4c12b5357c40370ab7e549703635ea8afe8ffba18edebc2a2db85c0ee62b9be8060e124a8502ccdcd4d5af6197ad21c4aeddedc9cd31bf0f7c0b98330c4d4f0b0d9e880c5b998b27f7832013d9c6b6c26ec71b314926fbfaf3d683e7665db582ae731e631d5b2cc6bc8cb77edebed893706e0feb882747d2eddee3ff09dc97a37133ec070ad3ca00dd850286362781f29bbe78f41f4565b7d9ffb5a3a4b86ac175c5c33ca8ece4659a9e724f8ff4fa607797b31d9dd45af1aa1a508127c9d8b465ceba8a8a4844ff55e111e73444c5e2989fb18fd010d9b2f6ee94aa7c44cfee46656ee1be4318acaa2e00a39edf548e9d5ae129fa7f0dfb66ad1e63b824a6df9f03f44c2ccaa9faf36cf2867e67e2cdf1a1d8ebab0d285930b55da375ae964894a7eea7987e92c69f5547d59d33de9b4724121ceb65f3ff50c5bce5ae6b01fd0a80239c692557c1f2bd8f2e981cae9a934da46e5ac1cf8c57c728c51a53b107f334e71e18157e03db02c9b73c81ac192d173ff85a6847f601493f66f087b76855fe9032d683106781bedcbdca6c0398206fd74191991b8feb11568100b4eee81665e5e8dd90090149be367d766a5b7c37c56b305a14a4ac0429741138a026a3340b619784e7cacec5ba1a01c97bc87415744f7e81f9ed4b887bfd218a8b9716a85fdad366e217a42b72fc291de8402ac10fce0abf04a784d06516b45ad0e37c6da433d68c9c81c53efc57a6f91c11d7349ee72f35ca1969be5302f4a0a8982e0e9f66a3208f5bddce11a58c0e8ee2ec9b6d08fbff015783aaaae441c1cf107776aca9877df1ae9bf5f01835c0d992702ab77834e9f4d1acbcad8aa814c25231502c2e3149d4658900193f2cd2e36ad457974fcaf53bc4ae8f3ccc9cd07b27f878e73c67b8c86b2814c58e58f0745019b3b9438018b9a21aa3936c49c8b734b7bd07f9mariadbmariadb-adminmariadb-checkmariadbd-safe-helpermariadb-dumpmariadb-importmariadb-showrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmariadb-10.6.15-150400.3.29.3.src.rpmconfig(mariadb-client)group(mysql)mariadb-clientmariadb-client(x86-64)mysql-clientuser(mysql)@@@@@@@@@@@@@@@@ @@@@@@@@@@@@@     /bin/shconfig(mariadb-client)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libedit.so.0()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libmariadb3libncurses.so.6()(64bit)libncurses.so.6(NCURSEST6_5.7.20081102)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libssl.so.1.1(OPENSSL_1_1_1)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)libz.so.1()(64bit)mariadb-errormessagesrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysuser-shadow10.6.15-150400.3.29.33.010.6.153.0.4-14.6.0-14.0-15.2-13.2mysql-client4.14.3dddlcc*c @bkb'E@b @a@a@aKaKaW@aba@a~@a^@a]aHwa6a@aG```KW`*b@`@`@_ǁ_#__N7_N7_3_'@^y^א^^Ǿ^@^@^v^y@^V]^U @^U @^O@^=Q@^:@^9\^9\^6^*@^,]@]@]M@]@]p]L]J@]D%]D%]9]8H@]\]@\ڭ\N\@\v{\n\j@\f\eX@\b@\-@\@\w[@[G[t[Q@[9@[[ @[M@[WZ@Z@Z@ZZ@ZH@Z$ZZaZOhZKt@Z;@ZZ@Z@YeYeY@YYcl@Y-^X@X,XpXXbWXAb@X W]NW+5V@V\:@UM@U@U@U>U@UJ@U-@U-@U@U.@T@TPT7T@TT_W@danilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comgmbr3@opensuse.orgdanilo.spinella@suse.comdanilo.spinella@suse.comsuse-beta@cboltz.dedanilo.spinella@suse.comjsegitz@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comrpm@fthiessen.dedimstar@opensuse.orgkstreitova@suse.comkstreitova@suse.commrueckert@suse.demrueckert@suse.demrueckert@suse.dekstreitova@suse.commarec@detebe.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgkstreitova@suse.comdimstar@opensuse.orgguillaume.gardet@opensuse.orgpgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comidonmez@suse.commliska@suse.czkukuk@suse.comschwab@suse.depgajdos@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comstefan.bruens@rwth-aachen.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.commliska@suse.czkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comsuse+build@de-korte.orgrick.salevsky@suse.comtbechtold@suse.comnicolas.bock@suse.comkstreitova@suse.comkstreitova@suse.comadrian.glaubitz@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkukuk@suse.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comro@suse.dersalevsky@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.orgkstreitova@suse.comrhafer@suse.devcizek@suse.comkstreitova@suse.comvcizek@suse.combwiedemann@suse.comvcizek@suse.comkstreitova@suse.comfvogt@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.org13ilya@gmail.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commichal.hrusecky@opensuse.orgmichal.hrusecky@opensuse.orgdvaleev@suse.comsweet_f_a@gmx.demichal.hrusecky@opensuse.orgmgorse@suse.comxrigou@otenet.grxrigou@otenet.grmichal.hrusecky@opensuse.orgledest@gmail.com- Update to 10.6.15: https://mariadb.com/kb/en/mariadb-10-6-15-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-15-changelog/ * fixes for the following security vulnerabilities: 10.6.15: none- Update to 10.6.14: https://mariadb.com/kb/en/mariadb-10-6-14-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-14-changelog/ * fixes for the following security vulnerabilities: 10.6.14: none- Update to 10.6.13: https://mariadb.com/kb/en/mariadb-10-6-13-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-13-changelog/ * fixes for the following security vulnerabilities: 10.6.13: CVE-2022-47015 (bsc#1207404) - Update list of skipped tests- Update to 10.6.12: https://mariadb.com/kb/en/library/mariadb-10612-release-notes https://mariadb.com/kb/en/library/mariadb-10612-changelog https://mariadb.com/kb/en/library/mariadb-10611-release-notes https://mariadb.com/kb/en/library/mariadb-10611-changelog * fixes for the following security vulnerabilities: 10.6.12: none 10.6.11: none - Update mariadb.keyring - Update list of skipped tests- Update to 10.6.10: https://mariadb.com/kb/en/library/mariadb-10610-release-notes https://mariadb.com/kb/en/library/mariadb-10610-changelog * fixes for the following security vulnerabilities: 10.6.10: none- Update to 10.6.9: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1069-release-notes https://mariadb.com/kb/en/library/mariadb-1069-changelog * fixes for the following security vulnerabilities: 10.6.9: CVE-2022-32082 (bsc#1201162) CVE-2022-32089 (bsc#1201169) CVE-2022-32081 (bsc#1201161) CVE-2022-32091 (bsc#1201170) CVE-2022-32084 (bsc#1201164) CVE-2022-38791 (bsc#1202863) * The package is not affected by the following security vulnerabilities: CVE-2018-25032 (bsc#1197459) - Update mysql-systemd-helper to be aware of custom group, bsc#1200105 - Update list of skipped tests- Update to 10.6.8 (bsc#1199928): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1068-release-notes https://mariadb.com/kb/en/library/mariadb-1068-changelog * fixes for the following security vulnerabilities: 10.6.8: CVE-2021-46669 CVE-2022-27376 (bsc#1198628) CVE-2022-27377 (bsc#1198603) CVE-2022-27378 (bsc#1198604) CVE-2022-27379 (bsc#1198605) CVE-2022-27380 (bsc#1198606) CVE-2022-27381 (bsc#1198607) CVE-2022-27382 (bsc#1198609) CVE-2022-27383 (bsc#1198610) CVE-2022-27384 (bsc#1198611) CVE-2022-27386 (bsc#1198612) CVE-2022-27387 (bsc#1198613) CVE-2022-27444 (bsc#1198634) CVE-2022-27445 (bsc#1198629) CVE-2022-27446 (bsc#1198630) CVE-2022-27447 (bsc#1198631) CVE-2022-27448 (bsc#1198632) CVE-2022-27449 (bsc#1198633) CVE-2022-27451 (bsc#1198639) CVE-2022-27452 (bsc#1198640) CVE-2022-27455 (bsc#1198638) CVE-2022-27456 (bsc#1198635) CVE-2022-27457 (bsc#1198636) CVE-2022-27458 (bsc#1198637) CVE-2022-32088 (bsc#1201168) CVE-2022-32087 (bsc#1201167) CVE-2022-32086 (bsc#1201166) CVE-2022-32085 (bsc#1201165) CVE-2022-32083 (bsc#1201163) - Update list of skipped tests - The following issue is not affecting this package: * CVE-2022-21427- Build mariadb-galera on SLE (jsc#SLE-22245) - Add dependency on galera-4 for mariadb-galera - Remove old constraints for mariadb-galera- Update to 10.6.7 (bsc#1196016): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1067-release-notes https://mariadb.com/kb/en/library/mariadb-1067-changelog https://mariadb.com/kb/en/library/mariadb-1066-release-notes https://mariadb.com/kb/en/library/mariadb-1066-changelog * fixes for the following security vulnerabilities: 10.6.7: CVE-2021-46665 CVE-2021-46664 CVE-2021-46661 CVE-2021-46668 CVE-2021-46663 10.6.6: CVE-2022-24052 CVE-2022-24051 CVE-2022-24050 CVE-2022-24048 CVE-2021-46659, bsc#1195339 - Skip failing tests for s390x, fixes bsc#1195076 * suse_skipped_tests.list - Remove upstreamed patches: * mariadb-10.0.15-logrotate-su.patch * mariadb-10.1.1-mysqld_multi-features.patch - Refresh mariadb-10.2.4-logrotate.patch - The following issues have already been fixed in this package but weren't previously mentioned in the changes file: CVE-2021-46658, bsc#1195334 CVE-2021-46657, bsc#1195325- The following issues have already been fixed in this package but weren't previously mentioned in the changes file: bsc#1189320 CVE-2021-2154, bsc#1185872 CVE-2021-2166, bsc#1185870 CVE-2021-27928, bsc#1183770 MDEV-23851- Fix rpmlint errors - Run spec-cleaner- Enable LZ4 compression for INNODB and ROCKSDB, fixes bsc#1186031- Revert systemd hardening * Remove harden_mariadb.service.patch- Add CONFIG parameter to %sysusers_generate_pre- Update to 10.6.5 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1065-release-notes https://mariadb.com/kb/en/library/mariadb-1065-changelog * fixes for the following security vulnerabilities: 10.6.5: none - Not affected by [CVE-2021-35604], bsc#1192497 - Drop upstreamed patch: * mariadb-10.2.19-link-and-enable-c++11-atomics.patch- Use pam macros instead of hardcoding directories, fixes bsc#1191038 - Add fix-pamdir.patch- Add func_math_tests_MDEV-26645.diff to avoid test failures in the func_math test on Tumbleweed s390x and ppc64 until MDEV-26645 gets fixed upstream- Fix socket address in mariadb@.socket file- Added hardening to systemd service(s) (bsc#1181400). Added patch(es): * harden_mariadb.service.patch Modified: * mariadb.service.in- Replace %{_rpmconfigdir}/macros.d with %{_rpmmacrodir}, remove ownership of this directory. Fixes boo#1182218 - Run spec-cleaner- Update to 10.6.4 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1064-release-notes https://mariadb.com/kb/en/library/mariadb-1064-changelog https://mariadb.com/kb/en/library/mariadb-1063-release-notes https://mariadb.com/kb/en/library/mariadb-1063-changelog https://mariadb.com/kb/en/library/mariadb-1062-release-notes https://mariadb.com/kb/en/library/mariadb-1062-changelog https://mariadb.com/kb/en/library/mariadb-1061-release-notes https://mariadb.com/kb/en/library/mariadb-1061-changelog https://mariadb.com/kb/en/library/mariadb-1060-release-notes https://mariadb.com/kb/en/library/mariadb-1060-changelog * fixes for the following security vulnerabilities: 10.6.4: CVE-2021-2372 CVE-2021-2389 - Removed support to tokudb as it has been removed from upstream - Refresh mariadb-10.2.4-fortify-and-O.patch - Add new systemd socket from upstream- Support both rpmlint 1.x and 2.x.- Update rpmlint rules in order to work with rpmlint2 (bsc#1179049).- Update to version 10.5.10 * Fix CVE-2021-2154 * Add ST_DISTANCE_SPHERE for calculating the spherical distance between two geometries (point or multipoint) on a sphere * Fix: Crash with invalid multi-table update of view in 2nd execution of SP * Fix: Incorrect name resolution for subqueries in ON expressions * Fix: Complex query in Store procedure corrupts results * Fix: DELETE HISTORY may delete current data on system-versioned table * Fix: Crashes with nested table value constructors * Fix: Server crashes in thd_clear_errors() * Fix: The statement set password=password('') executed in PS mode fails in case it is run by a user with expired password * Full changes: https://mariadb.com/kb/en/mariadb-10510-changelog/ - Drop mariadb-10.5.9-cmake-3.20.patch, applied upstream- Add mariadb-10.5.9-cmake-3.20.patch: Fix syntax error which is exposed by cmake 3.20.- Update to 10.5.9 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1059-release-notes https://mariadb.com/kb/en/library/mariadb-1059-changelog * fixes for the following security vulnerabilities: 10.5.9: none - Tracker bug: [bsc#1182739] - Update fixes [bsc#1182255] (MDL BF-BF Conflict caused by TRUNCATE TABLE) - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - remove fix-lock-rollback-assert-abort.patch (applied upstream)- update the list of the skipped tests- exclude galera files if we build without this feature. - switch from 664 to 644 for my.cnf configuration file (probably a typo)- added fix-lock-rollback-assert-abort.patch fix an abort when a transaction is rolled back - track all patches in a series so we can easily set up a quilt tree without requiring all the devel packages- switch to bcond_with to make it easier to enable galera support via the prjconfig - fix non galera case for building- Update to 10.5.8 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1058-release-notes https://mariadb.com/kb/en/library/mariadb-1058-changelog * fixes for the following security vulnerabilities: 10.5.7: CVE-2020-14812, CVE-2020-14765, CVE-2020-14776, CVE-2020-14789 10.5.8: none - tracker bugs: [bsc#1177472] and [bsc#1178428] - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - update suse_skipped_tests.list- update to 10.5.6 * release notes and changelog https://mariadb.com/kb/en/mariadb-1056-release-notes https://mariadb.com/kb/en/mariadb-1056-changelog * fixes for the following security vulnerabilities: 10.5.6: CVE-2020-15180 < 10.5.6: none - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - drop mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch - mariadb now builds against pcre2 - added binaries aria_s3_copy and mariadb-conv to tools subpackage - added type_test.type_test_double to list of skipped tests- Using basic.target dependencies is not needed with any systemd release unless DefaultDependencies is disabled, remove from unit files- Mariadb uses hrtimers with absolute CLOCK_REALTIME values, this won't work correctly if the clock isn't set and will do funny things if it goes backward after starting the server as POSIX says that the new clock value shall influence them, start the service after time-sync.target to workaround the problem.- Update to 10.4.14 [bsc#1175596] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10414-release-notes https://mariadb.com/kb/en/library/mariadb-10414-changelog * fixes for the following security vulnerabilities: none * the update fixes [bsc#1174559] and [bsc#1173516] (MariaDB crashes at db_sync from Keystone) - refresh mariadb-10.2.4-fortify-and-O.patch - fix patch sequence - run spec-cleaner - build galera for openSUSE only - update suse_skipped_tests.list - tune the testsuite to avoid randomly failing tests- Fix installed .service files to follow the /usr/lib -> /usr/libexec move (boo#1174811).- Update _constraints to make it more readable and request more memory for aarch64 to avoid occasionnal OOM errors on %check- rpm macros: $TEST_USER identified by $TEST_PASS is actually user of the database for which client conf should be made for - rpm macros: database name or names can be specified as a %mysql_testserver_start and %mysql_testserver_cconf parameter - modified sources % macros.mariadb-test- Build with oqgraph by default for all codestreams [jsc#SLE-12253]- Update to 10.4.13 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10413-release-notes https://mariadb.com/kb/en/library/mariadb-10413-changelog * fixes for the following security vulnerabilities: CVE-2020-2752, CVE-2020-2812, CVE-2020-2814, CVE-2020-2760, CVE-2020-13249 - fixes [bsc#1168380] (the same as [bsc#1166781]) MDEV-21244 mysql_upgrade creating empty global_priv table support upgrades from 5.2 privilege tables - drop specfile "hacks" as things work correctly in upstream now: * renaming tmpfiles.conf -> mariadb.conf * installing pam_user_map.so to /lib64/security for non 32bit architectures * sysusers.conf was renamed to mariadb.conf - update suse_skipped_tests.list- move mariadb-client-test from client subpackage to test subpackage so the symlink from mariadb-client-test -> mysql_client_test works [bsc#1170204]- Add oqgraph.social to the suse_skipped_tests.list (reported upstream as MDEV-22280) [bsc#1169369]- Add -Wl,-Bsymbolic -Wl,-Bsymbolic-functions to linker flags so that symbols are resolved locally if possible, this will avoid https://bugs.kde.org/show_bug.cgi?id=391362- Add mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch in order to fix boo#1158405 (MDEV-21248).- Cleanup mysql user creation/handling and use sysusers.d- Bump disk constraint to 18Gb- test macros: clarify who is admin and user of the database, fix build with 10.4 - modified sources % macros.mariadb-test- remove @VERSION@ from mariadb.service and mariadb@.service- disable testing with rpm macros as it does not work as for 10.4, needs to be investigated- update suse_skipped_tests.list for ppc- rename mariadb.rpmlintrc to mariadb-rpmlintrc - for ppc install pam_user_map.so in /lib/security- rename mariadb-10.2.12-harden_setuid.patch to mariadb-10.4.12-harden_setuid.patch to match the correct version number. - add mariadb-10.4.12-fix-install-db.patch to improve default behaviour of mysql_install_db. This prevents performing security sensitive actions to be performed but instead only warns the caller (bsc#1160868).- update to 10.4.12 [jsc#SLE-8269] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10412-release-notes https://mariadb.com/kb/en/library/mariadb-10412-changelog https://mariadb.com/kb/en/library/mariadb-10411-release-notes https://mariadb.com/kb/en/library/mariadb-10411-changelog * fixes for the following security vulnerabilities: CVE-2020-2574 * don't let mysql_install_db set SUID bit for auth_pam_tool in rpm/deb packages CVE-2020-7221 [bsc#1160868] - add mariadb-10.2.12-harden_setuid.patch to harden auth_pam_tool setuid-root binary [bsc#1160285] - pack pam_user_map.so module in the /%{_lib}/security directory and user_map.conf configuration file in the /etc/security directory - fix race condition with mysql_upgrade_info status file by moving it to the location owned by root (/var/lib/misc) CVE-2019-18901 [bsc#1160895] - move .run-mysql_upgrade file from $datadir/.run-mysql_upgrade to /var/lib/misc/.mariadb_run_upgrade so the mysql user can't use it for a symlink attack [bsc#1160912] - change -DWITH_COMMENT and -DCOMPILATION_COMMENT to be SUSE/openSUSE independent- enhance mariadb.service and mariadb@.service with various options (Documentation=, User=, Group=, KillSignal=, SendSIGKILL=, Restart=, RestartSec=, CapabilityBoundingSet=, ProtectSystem=, ProtectHome=, PermissionsStartOnly= and UMask=) [bsc#1160878] - mysql-systemd-helper: use systemd-tmpfiles instead of shell script operations for a cleaner and safer creating of /run/mysql [bsc#1160883]- update to 10.4.10 * changes and improvements for 10.4 https://mariadb.com/kb/en/changes-improvements-in-mariadb-104/ * fixes for the following security vulnerabilities: none - pack mariadb variants of the mysql binaries (e.g. mariadb-dumpslow is a symlink to mysqldumpslow and the like) - refresh mariadb-10.2.4-fortify-and-O.patch - update suse_skipped_tests.list - _constraints: increase physicalmemory value - package auth_pam_tool setuid binary properly - add cracklib-password-check subpackage but do not build it right now (cracklib-dict-full >= 2.9.0 is not available yet) - add rcmariadb compat link - add mariadb.rpmlintrc file - do not move my_safe_process to bindir but use rpmlint arch-dependent-file-in-usr-share exception for it (this file is used just for the testing and it doesn't have to be in bindir- added rpm test macros: %mysql_testserver_start, %mysql_testserver_cconf, %mysql_testserver_stop First two consuments are python-sortinghat and python-mysqlclient.- update the list of the skipped tests- update to 10.3.20 * notable changes for 10.3.20 * MDEV-20987: InnoDB fails to start when FTS table has FK relation * notable changes for 10.3.19 * MDEV-20864: Debug-only option innodb_change_buffer_dump for dumping the contents of the InnoDB change buffer to the server error log at startup. * MariaBackup: * MDEV-18438: mbstream recreates xtrabackup_info on same directory as backup file * MDEV-20703: mariabackup creates binlog files in serve binlog directory on --prepare --export step * FULLTEXT INDEX: * MDEV-19647: Server hangs after dropping full text indexes and restart * MDEV-19529: InnoDB hang on DROP FULLTEXT INDEX * MDEV-19073: FTS row mismatch after crash recovery * MDEV-20621: FULLTEXT INDEX activity causes InnoDB hang * MDEV-20927: Duplicate key with auto increment * ALTER TABLE: * MDEV-20799: DROP Virtual Column crash * MDEV-20852: BtrBulk is unnecessarily holding dict_index_t::lock * System-Versioned Tables: * MDEV-16210: FK constraints on versioned tables use historical rows, which may cause constraint violation * MDEV-20812: Unexpected ER_ROW_IS_REFERENCED_2 or server crash in row_ins_foreign_report_err upon DELETE from versioned table with FK * Galera wsrep library updated to 25.3.28 * Fixes for the following security vulnerabilities: CVE-2019-2974, CVE-2019-2938 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10320-release-notes https://mariadb.com/kb/en/library/mariadb-10320-changelog https://mariadb.com/kb/en/library/mariadb-10319-release-notes https://mariadb.com/kb/en/library/mariadb-10319-changelog - remove mariadb-10.3.17-fix_ppc_build.patch (applied upstream) - refresh * mariadb-10.2.4-logrotate.patch * mariadb-10.0.15-logrotate-su.patch- update to 10.3.18 * notable changes * Connect updated to Connect 1.06.0010 * MDEV-20066: This bug could cause a table to become corrupt if a column was added instantly * MDEV-15326: A race condition in InnoDB transaction commit that affects record locking was fixed * MDEV-17187: Table doesn't exist in engine after ALTER of FOREIGN KEY * MDEV-20301: InnoDB's MVCC has O(N^2) behaviors * MDEV-18128: Simplify .ibd file creation * MDEV-20060: Failing assertion: srv_log_file_size <= 512ULL << 30 while preparing backup * MDEV-20247: Replication hangs with "preparing" and never starts * MDEV-17614: Remove unnecessary locking for INSERT...ON DUPLICATE KEY UPDATE * MDEV-20311: row_ins_step accesses uninitialized memory * MDEV-19947: Repositories for RHEL 8 ppc64le added * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10318-release-notes https://mariadb.com/kb/en/library/mariadb-10318-changelog- Use instead of for _constraints, increasing the worker pool on x86_64 from 6 to >700.- remove sql_mode from my.ini/my.cnf as NO_ENGINE_SUBSTITUTION and STRICT_TRANS_TABLES are already set by default from version 10.2.4 [bsc#1144314]- add mariadb-10.3.17-fix_ppc_build.patch to fix a compilation failure for ppc if ${CRC32_LIBRARY} target has no COMPILE_FLAGS yet. Then GET_TARGET_PROPERTY returns COMPILE_FLAGS-NOTFOUND, which doesn't work very well when it's later fed back into COMPILE_FLAGS. - _constraints: increase the memory because of the ppc build - adjust mysql-systemd-helper ("shutdown protected MySQL" section) so it checks both ping response and the pid in a process list as it can take some time till the process is terminated. Otherwise it can lead to "found left-over process" situation when regular mariadb is started [bsc#1143215]- update to 10.3.17 [bsc#1141798] * notable changes: * MDEV-19795: Merge upstream MyRocks. * MDEV-17228: Encrypted temporary tables are not encrypted. * MDEV-18328: Disks Plugin is now stable and requires the FILE privilege. * Merge relevant InnoDB changes from MySQL 5.7.27 * Adjust spin loops to the x86 PAUSE instruction latency * CREATE TABLE: MDEV-19292, MDEV-20102 * ALTER TABLE: MDEV-15641, MDEV-19630, MDEV-19916, MDEV-19974 * Indexed virtual columns: MDEV-16222, MDEV-17005, MDEV-19870 * FULLTEXT INDEX: MDEV-14154 * Encryption: MDEV-17228, MDEV-19914 * Galera + FOREIGN KEY: MDEV-19660 * Recovery & Mariabackup: MDEV-19978 * MDEV-19781: Add page id matching check in innochecksum tool * MDEV-20091: DROP TEMPORARY table is logged despite no CREATE was logged * MDEV-19427: mysql_upgrade_service throws exception upgrading from 10.0 to 10.3 * MDEV-19814: Server crash in row_upd_del_mark_clust_rec or Assertion * MDEV-17363: Compressed columns cannot be restored from dump * fixes for the following security vulnerabilities: CVE-2019-2805, CVE-2019-2740, CVE-2019-2739, CVE-2019-2737, CVE-2019-2758 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10317-release-notes https://mariadb.com/kb/en/library/mariadb-10317-changelog - add "BuildRequires: python3" as some tests and myrocks_hotbackup script need python3. Make the PYTHON_SHEBANG value configurable [bsc#1142909] - remove "innodb_file_format" option from my.ini (my.cnf) file that was removed in MariaDB 10.3.1. Also remove "innodb_file_per_table=ON" option that is by default ON and it's redundant now. - remove mariadb-10.2.9-galera_cnf.patch as it's not clear what the correct path to galera wsrep provider is while users can use galera 3, galera 4 or galera compiled on their own - add "Requires: python3-mysqlclient" that is needed by myrocks_hotbackup script- Use FAT LTO objects in order to provide proper static library.- remove client_ed25519.so plugin because it's shipped in mariadb-connector-c package (libmariadb_plugins)- removal of SuSEfirewall2 service, since SuSEfirewall2 has been replaced by firewalld, see [1]. [1]: https://lists.opensuse.org/opensuse-factory/2019-01/msg00490.html- update to 10.3.16 [bsc#1108088] * notable changes: * MDEV-19490: show tables fails when selecting the information_schema database * MDEV-19491: multi-update with triggers and stored routines * MDEV-19541: InnoDB crashes when trying to recover a corrupted page * MDEV-19725: Incorrect error handling in ALTER TABLE * MDEV-19445: FULLTEXT INDEX fix * MDEV-19486: System Versioning fix * MDEV-19509: InnoDB skips the tablespace in rotation list * MDEV-19614: SET GLOBAL innodb_ deadlock due to LOCK_global_system_variables * MDEV-17458: Unable to start galera node * MDEV-17456: Malicious SUPER user can possibly change audit log configuration without leaving traces * MDEV-19588: Wrong results from query, using left join * MDEV-19258: RIGHT JOIN hangs in MariaDB * Virtual columns fixes: MDEV-19027, MDEV-19602 * Crash recovery fixes: MDEV-13080, MDEV-19587, MDEV-19435 * MDEV-11094: Fixed row-based event applying with an error anymore when the events aim at the blackhole engine and row annotation is enabled * MDEV-19076: Fixed slave_parallel_mode=optimistic did not always properly order replication events on temporary tables in some case to attempt execution before a parent event has been already processed * MDEV-19158: Fixed duplicated entries in binlog occurred in combination of LOCK TABLES and binlog_format=MIXED when a being locked table was under replication unsafe operation * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10316-release-notes https://mariadb.com/kb/en/library/mariadb-10316-changelog - fix reading options for multiple instances if my${INSTANCE}.cnf is used. Also remove "umask 077" from mysql-systemd-helper that causes that new datadirs are created with wrong permissions. Set correct permissions for files created by us (mysql_upgrade_info, .run-mysql_upgrade) [bsc#1132666] - remove mariadb-5.5.28-install_db-quiet.patch and add "--rpm" option to the mysql_install_db script that does basically the same [bsc#1080891] - remove mariadb-10.1.12-deharcode-libdir.patch because it's not needed - we don't build libmariadb library in mariadb package anymore so we don't need to take care about LIBDIR and PLUGINDIR here. Moreover we shouldn't (and we don't) touch *_RPM variables as they are internal) [bsc#1080891] - update suse_skipped_tests.list- update to 10.3.15 * see changes in 10.3 series https://mariadb.com/kb/en/library/changes-improvements-in-mariadb-103/ * fixes for the following security vulnerabilities: [CVE-2019-2503] (the rest was already applied for 10.2) - remove mysql-community-server-5.1.45-multi-configuration.patch as we have the same configuration in /etc/my.cnf and it doesn't make any sense to keep it twice. Moreover the patched file support-files/my-medium.cnf.sh was removed in upstream - remove mariadb-5.2.3-cnf.patch as all patched files were removed upstream - refresh mariadb-10.2.4-fortify-and-O.patch - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch and use a simplified version from Debian - refresh README.install and suse-test-run - remove caching_sha2_password.so as it's shipped in mariadb-connector-c package (libmariadb_plugins) - rename libmysqld subpackage (embedded library) to libmariadbd as libmysqld.so was renamed to libmariadbd.so (MDEV-14953) - simplify removing static libs (we don't need to have .static) - add perl(Memoize) and perl(Symbol) to BuildRequires and Requires that are needed for tests - replace Requires pwdutils with shadow - build RocksDB only for x86_64 as other platforms are not supported - remove xtrabackup scripts as we already removed xtrabackup requires and it doesn't work for MariaDB 10.3 anyway - run spec-cleaner - tracker bugs for version updates in between: * 10.2.25 tracker bug [bsc#1136035] * 10.2.29 tracker bug [bsc#1156669]- update to 10.2.24 GA [bsc#1122198] * notable changes: * MDEV-18968 - Both (WHERE 0.1) and (WHERE NOT 0.1) return empty set * MDEV-18466 - Unsafe to log updates on tables referenced by foreign keys with triggers in statement format * MDEV-18899 - Server crashes in Field::set_warning_truncated_wrong_value * MDEV-18298 - Crashes server with segfault during role grants * MDEV-17610 - Unexpected connection abort after certain operations from within stored procedure * MDEV-19112 - WITH clause does not work with information_schema as default database * MDEV-17830 - Server crashes in Item_null_result::field_type upon SELECT with CHARSET(date) and ROLLUP * MDEV-14041 - Server crashes in String::length on queries with functions and ROLLUP * MDEV-18920 - Prepared statements with st_convexhull hang and eat 100% cpu. * MDEV-15837 - Assertion item1->type() == Item::FIELD_ITEM && item2->type() == Item::FIELD_ITEM * MDEV-9531 - GROUP_CONCAT with ORDER BY inside takes a lot of memory while it's executed * MDEV-17036 - BULK with replace doesn't take the first parameter in account * Bug#28986737 - RENAMING AND REPLACING MYSQL.USER TABLE CAN LEAD TO A SERVER CRASH * MDEV-19350 - Server crashes in delete_tree_element / ... / Item_func_group_concat::repack_tree * MDEV-19188 - Server Crash When Using a Trigger With A Number of Virtual Columns on INSERT/UPDATE * MDEV-19352 - Server crash in alloc_histograms_for_table_share upon query from information schema InnoDB * InnoDB persistent corruption fixes: MDEV-19426, MDEV-19022, MDEV-19241, MDEV-13942 * InnoDB recovery fixes and speedup: MDEV-18733, MDEV-12699, MDEV-19356, MDEV-19426 * MDEV-14398 - innodb_encrypt_tables will work even with innodb_encryption_rotate_key_age=0 * MDEV-17036 - BULK with replace doesn't take the first parameter in account * MDEV-14784 - Slave crashes in show_status_array upon running a trigger with select from I_S * MDEV-19060 - mariabackup continues, despite failing to open a tablespace * MDEV-18686 - Add option to PAM authentication plugin to allow case insensitive username matching * bugfix - multi-update checked privileges on views incorrectly * MDEV-19276 - during connect, write error log warning for ER_DBACCESS_DENIED_ERROR, if log_warnings > 1 * MDEV-17456 - Malicious SUPER user can possibly change audit log configuration without leaving traces. * fixes for the following security vulnerabilities: [CVE-2019-2614], [CVE-2019-2627], [CVE-2019-2628] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10224-release-notes https://mariadb.com/kb/en/library/mariadb-10224-changelog - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch- remove %{extra_provides} definition and Provides/Obsoletes where it was used. It's just a remnant and it's no longer needed.- update to 10.2.23 GA * notable changes: * InnoDB ALTER TABLE fixes: MDEV-18016, MDEV-18630, MDEV-18775, MDEV-18732, MDEV-18749, MDEV-18637, MDEV-13818, MDEV-17595 * MDEV-18878: InnoDB Purge: Optimize away futile table lookups * MDEV-14984: Regression in connect performance * MDEV-18936: Purge thread fails to exit on shutdown * MDEV-18272: InnoDB fails to rollback after exceeding FOREIGN KEY recursion depth * MDEV-9519: Data corruption on Galera cluster size change * MDEV-18204: fix incremental MyRocks backup * MDEV-18611: mariabackup terminated while copying InnoDB redo log * MDEV-18669: mariabackup writes timestamp in version line * MDEV-18855: Mariabackup should fetch innodb_compression_level from running server * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10223-release-notes https://mariadb.com/kb/en/library/mariadb-10223-changelog - remove mariadb-10.2.22-fix_path.patch that is no longer needed (applied upstream)- add mariadb-10.2.22-fix_path.patch to fix a path to resolveip in mysql_install_db script [bsc#1127027] MDEV-18526- my.cnf/my.ini: move slow_query_log example to the error log so it's logically together- fix references path below legacy directory /var/run -> /run- remove xtrabackup requirement as MariaDB ships a build in mariabackup so xtrabackup is not needed unless a user specificaly wants to use xtrabackup as sst method (also solves [bsc#1122475]- add slow_query_log example to my.cnf and adjust the logrotate configuration to rotate all /var/log/mysql/*.log files . This is useful when the slow query log is enabled. In that case, this log file should also be rotated (bsc#1112767)- update to 10.2.22 GA * notable changes: * Backport Information Schema CHECK_CONSTRAINTS Table. * MDEV-17475: Maximum value of table_definition_cache is now 2097152 * InnoDB ALTER TABLE fixes: MDEV-16499, MDEV-18186, MDEV-18237, MDEV-18222, MDEV-18256, MDEV-18016, MDEV-16849 * Mariabackup fixes: MDEV-18185, MDEV-18201, MDEV-18194 * Galera crash recovery fix: MDEV-15740 * Encryption fixes: MDEV-18129, MDEV-18183, MDEV-18279 * Fixes for the following security vulnerabilities: * CVE-2019-2510, CVE-2019-2537 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10222-release-notes https://mariadb.com/kb/en/library/mariadb-10222-changelog- update to 10.2.21 GA * notable changes: * MDEV-17589 - Stack-buffer-overflow with indexed varchar (utf8) field * MDEV-16987 - ALTER DATABASE possible in read-only mode (forbid ALTER DATABASE in read_only) * MDEV-17720 - slave_ddl_exec_mode=IDEMPOTENT does not handle DROP DATABASE * MDEV-6453 - Assertion `inited==NONE || (inited==RND && scan)' failed in handler::ha_rnd_init(bool) with InnoDB, joins, AND/OR conditions * MDEV-18105 - Mariabackup fails to copy encrypted InnoDB system tablespace if LSN>4G * MDEV-18041 - Database corruption after renaming a prefix-indexed column [bsc#1120041] * MDEV-17470 - Orphan temporary files after interrupted ALTER cause InnoDB: Operating system error number 17 and eventual fatal error 71 * MDEV-17833: ALTER TABLE is not enforcing prefix index size limit * MDEV-17989: InnoDB: Failing assertion: dict_tf2_is_valid(flags, flags2) * MDEV-17765: Locking bug fix for SPATIAL INDEX * MDEV-17923, MDEV-17904, MDEV-17938: Fixes for FULLTEXT INDEX * Fixes for regressions introduced in MariaDB Server 10.2.19 by the backup-safe TRUNCATE TABLE (MDEV-13564, innodb_safe_truncate=ON) and innodb_undo_log_truncate: * MDEV-17780, MDEV-17816, MDEV-17849, MDEV-17851, MDEV-17885 * Several improvements to MariaDB Server and backup for dealing with encrypted or page_compressed pages: * MDEV-12112: corruption in encrypted table may be overlooked * MDEV-17958: On little-endian systems, remove bug-compatible variant of innodb_checksum_algorithm=crc32 * MDEV-17957: Make innodb_checksum_algorithm stricter for strict_* values * MDEV-18025: Mariabackup fails to detect corrupted page_compressed=1 tables * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10221-release-notes https://mariadb.com/kb/en/library/mariadb-10221-changelog https://mariadb.com/kb/en/library/mariadb-10220-release-notes https://mariadb.com/kb/en/library/mariadb-10220-changelog - update suse_skipped_tests.list- remove PerconaFT from the package as it has AGPL licence [bsc#1118754] - use a new syntax for cmake variables that specify which plugin will be built- Add patch to link against libatomic where necessary and use C++11 atomics instead of gcc built-in atomics * mariadb-10.2.19-link-and-enable-c++11-atomics.patch - Add two tests to suse_skipped_tests.list for ppc * encryption.innodb-bad-key-change2 * encryption.innodb-bad-key-change4- update to 10.2.19 GA [bsc#1116686] * notable changes: * innodb_safe_truncate system variable for a backup-safe TRUNCATE TABLE implementation that is based on RENAME, CREATE, DROP (MDEV-14717, MDEV-14585, MDEV-13564). Default value for this variable is ON. If you absolutely must use XtraBackup instead of Mariabackup, you can set it to OFF and restart the server * MDEV-17289: Multi-pass recovery fails to apply some redo log records * MDEV-17073: INSERT…ON DUPLICATE KEY UPDATE became more deadlock-prone * MDEV-17491: micro optimize page_id_t * MDEV-13671: InnoDB should use case-insensitive column name comparisons like the rest of the server * Fixes for indexed virtual columns: MDEV-17215, MDEV-16980 * MDEV-17433: Allow InnoDB start up with empty ib_logfile0 from mariabackup --prepare * MDEV-12547: InnoDB FULLTEXT index has too strict innodb_ft_result_cache_limit max limit * MDEV-17541: KILL QUERY during lock wait in FOREIGN KEY check causes hang * MDEV-17531: Crash in RENAME TABLE with FOREIGN KEY and FULLTEXT INDEX * MDEV-17532: Performance_schema reports wrong directory for the temporary files of ALTER TABLE…ALGORITHM=INPLACE * MDEV-17545: Predicate lock for SPATIAL INDEX should lock non-matching record * MDEV-17546: SPATIAL INDEX should not be allowed for FOREIGN KEY * MDEV-17548: Incorrect access to off-page column for indexed virtual column * MDEV-12023: Assertion failure sym_node->table != NULL on startup * MDEV-17230: encryption_key_id from alter is ignored by encryption threads * fixes for the following security vulnerabilities: CVE-2018-3282 [bsc#1112432], CVE-2016-9843 [bsc#1013882], CVE-2018-3174 [bsc#1112368], CVE-2018-3143 [bsc#1112421], CVE-2018-3156 [bsc#1112417], CVE-2018-3251 [bsc#1112397], CVE-2018-3185 [bsc#1112384], CVE-2018-3277 [bsc#1112391], CVE-2018-3162 [bsc#1112415], CVE-2018-3173 [bsc#1112386], CVE-2018-3200 [bsc#1112404], CVE-2018-3284 [bsc#1112377] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10219-release-notes https://mariadb.com/kb/en/library/mariadb-10219-changelog - do not pack libmariadb.pc (packed in mariadb-connector-c)- add "Requires: libmariadb_plugins" to the mariadb-test subpackage in order to be able to test client plugins successfuly [bsc#1111859] - don't remove debug_key_management.so anymore [bsc#1111858]- update to 10.2.18 GA * notable changes: * MDEV-15511 - if available, stunnel can be used during Galera rsync SST * MDEV-16791 - mariabackup: Support DDL commands during backup * MDEV-13564 - Refuse MLOG_TRUNCATE in mariabackup * MDEV-16934 - add new system variable eq_range_index_dive_limit to speed up queries that new long nested IN lists. The default value, for backward compatibility, is 0 meaning "unlimited". * MDEV-13333 - errors on InnoDB lock conflict * Report all InnoDB redo log corruption * MDEV-17043 - Purge of indexed virtual columns may cause hang on table-rebuilding DDL * MDEV-16868 - corruption of InnoDB temporary tables * MDEV-16465 - Invalid (old?) table or database name or hang in ha_innobase::delete_table and log semaphore wait upon concurrent DDL with foreign keys * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10218-release-notes https://mariadb.com/kb/en/library/mariadb-10218-changelog - refresh mariadb-10.2.4-fortify-and-O.patch- add ssl tests that are failing with OpenSSL 1.1.1 to suse_skipped_tests.list [MDEV-17184]- update to 10.2.17 GA * notable changes: * New variable innodb_log_optimize_ddl for avoiding delay due to page flushing and allowing concurrent backup * InnoDB updated to 5.7.23 * MDEV-14637 - Fix hang due to DDL with FOREIGN KEY or persistent statistics * MDEV-15953 - Alter InnoDB Partitioned Table Moves Files (which were originally not in the datadir) to the datadir * MDEV-16515 - InnoDB: Failing assertion: ++retries < 10000 in file dict0dict.cc line 2737 * MDEV-16809 - Allow full redo logging for ALTER TABLE * Temporary tables: MDEV-16713 - InnoDB hang with repeating log entry * indexed virtual columns: MDEV-15855 - Deadlock between purge thread and DDL statement * MDEV-16664 - Change the default to innodb_lock_schedule_algorithm=fcfs * Galera: MDEV-15822 - WSREP: BF lock wait long for trx * fixes for the following security vulnerabilities: CVE-2018-3064 [bsc#1103342], CVE-2018-3063 [bsc#1101677], CVE-2018-3058 [bsc#1101676], CVE-2018-3066 [bsc#1101678], CVE-2018-3060 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10217-release-notes https://mariadb.com/kb/en/library/mariadb-10217-changelog- switch to libedit as control sequences were already fixed there so we don't have to avoid it [bsc#1098683]- update to 10.2.16 GA * notable changes: * MDEV-13122: mariabackup now supports MyRocks * MDEV-13779 - InnoDB fails to shut down purge workers, causing hang * MDEV-16267 - Wrong INFORMATION_SCHEMA.INNODB_BUFFER_PAGE.\ TABLE_NAME * MDEV-13834 - Upgrade failure from 10.1 innodb_encrypt_log * MDEV-16283 - ALTER TABLE...DISCARD TABLESPACE still takes long on a large buffer pool * MDEV-16376 - ASAN: heap-use-after-free in gcol.innodb_virtual_debug * MDEV-15824 - innodb_defragment=ON trumps innodb_optimize_fulltext_only=ON in OPTIMIZE TABLE * MDEV-16124 - fil_rename_tablespace() times out and crashes server during table-rebuilding ALTER TABLE * MDEV-16416 - Crash on IMPORT TABLESPACE of a ROW_FORMAT=COMPRESSED table * MDEV-16456 - InnoDB error "returned OS error 71" complains about wrong path * MDEV-13103 - Deal with page_compressed page corruption * MDEV-16496 - Mariabackup: Implement --verbose option to instrument InnoDB log apply * MDEV-16087 - Inconsistent SELECT results when query cache is enabled * MDEV-15114 - ASAN heap-use-after-free in mem_heap_dup or dfield_data_is_binary_equal (fix for indexed virtual columns) * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10216-release-notes https://mariadb.com/kb/en/library/mariadb-10216-changelog - refresh mariadb-5.5.28-install_db-quiet.patch - refresh mariadb-10.2.9-galera_cnf.patch - pack wsrep_sst_rsync_wan file to galera subpackage - update suse_skipped_tests.list- Don't require systemd explicit, spec file can handle both cases correct and in containers we don't have systemd.- update to 10.2.15 GA * notable changes: * PCRE updated to 8.42 * The embedded server library now supports SSL when connecting to remote servers [bsc#1088681], [CVE-2018-2767] * MDEV-15325 - Incomplete validation of missing tablespace during recovery * MDEV-15720 - ib_buffer_pool unnecessarily includes the temporary tablespace * MDEV-15764 - InnoDB may write uninitialized garbage to redo log * MDEV-15553 - Virtual Columns: Assertion failed in dict_table_get_col_name * MDEV-14705 - slow innodb startup/shutdown can exceed systemd timeout * MDEV-15507 - Assertion failed in dict_check_sys_tables on upgrade from 5.5 * MDEV-15916 - Change buffer crash during TRUNCATE or DROP TABLE * encryption fixes - MDEV-12632, MDEV-13516, MDEV-15752, MDEV-15566, MDEV-16092 * temporary table ROLLBACK fixes - MDEV-15826, MDEV-15374 * applicable changes from 5.7.22 - MDEV-16142 * fixes for the following security vulnerabilities: CVE-2018-2786, CVE-2018-2759, CVE-2018-2777, CVE-2018-2810, CVE-2018-2782, CVE-2018-2784, CVE-2018-2787, CVE-2018-2766, CVE-2018-2755, CVE-2018-2819, CVE-2018-2817, CVE-2018-2761, CVE-2018-2781, CVE-2018-2771, CVE-2018-2813 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10215-release-notes https://mariadb.com/kb/en/library/mariadb-10215-changelog - update suse_skipped_tests.list and add tests that are failing with GCC 8 [bsc#1092544], MDEV-16127 - do not build TokuDB as a build without jemalloc is not supported upstream- update suse_skipped_tests.list and add failing tests for s390- update to 10.2.14 GA * notable changes: * MyRocks is now Gamma (RC) * MDEV-14533 - Added the DISKS plugin, for monitoring disk space * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY. * MDEV-15333 - MariaDB (still) slow start * MDEV-12255 - Wrong result with innodb_prefix_index_cluster_optimization * MDEV-12396 - IMPORT TABLESPACE cleanup * MDEV-14648 - Restore fix for MySQL BUG#39053 - UNINSTALL PLUGIN does not allow the storage engine to cleanup open connections * MDEV-15249 - IMPORT fixes * MDEV-14988 - innodb_read_only tries to modify files if transactions were recovered in COMMITTED state * MDEV-14773 - DROP TABLE hangs for InnoDB table with FULLTEXT index (fixing a recent regression from upstream) * MDEV-15529 - IMPORT TABLESPACE unnecessarily uses the doublewrite buffer * MDEV-15554 - InnoDB page_cleaner shutdown sometimes hangs * MDEV-14545 - Mariabackup - Backup fails due to MLOG_INDEX_LOAD record * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10214-release-notes https://mariadb.com/kb/en/library/mariadb-10214-changelog - remove the following patches * mariadb-10.2.14-xtrabackup-v2.patch (applied upstream, MDEV-15254) * mariadb-10.2.13-aarch_compilefix.patch (applied upstream, MDEV-14318) * mariadb-10.2.10-disable_openssl_compatibility_check.patch (fixed upstream in https://github.com/MariaDB/server/pull/558) * mariadb-10.2.8-systemd-cmake.patch and DWITH_SYSTEMD=ON compile option that are no longer needed - systemd is detected correctly now (discussed in [bsc#1080891] and MDEV-8379) * mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch (fixed upstream in 52516706c86f9f66c76836eabde7e2477694bac3) * remove mariadb-10.2.3-group.patch that was just a half solution of the group support (missing server part) and moreover using a group option in mysql-systemd-helper was removed few years ago as it caused troubles because MariaDB resolved it as 'group_concat_max_len option' (see https://github.com/openSUSE/mysql-packaging/issues/15) - remove jar files from the tarball (used for testing from the source) - build TokuDB without the jemalloc support for now. Jemalloc 5 is not backwards compatible which leads to the errors in the testsuite at least (MDEV-15034) - update suse_skipped_tests.list- change %{extra_provides} macro from "mariadb_102" to "mariadb-102" and use this macro in Provides/Obsoletes for mariadb, test, tools, bench and errormessages subpackages to ensure a smooth transition from SLE12 to SLE15 [fate#323756] - remove "Provides: mariadb-errormessages = 10.1.25" that shouldn't be needed anymore- fix build on aarch64: compile a few more files with -O0 from https://jira.mariadb.org/browse/MDEV-14318 add patch mariadb-10.2.13-aarch_compilefix.patch- add mariadb-10.2.14-xtrabackup-v2.patch (bsc#1083087)- update to 10.2.13 GA * notable changes * InnoDB updated to 5.7.21 * Galera wsrep library updated to 25.3.23 * MDEV-13869 - MariaDB slow start * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY * MDEV-15249 - Crash in MVCC read after IMPORT TABLESPACE * Foreign key bugs: * MDEV-15199 - Referential integrity broken in ON DELETE CASCADE/MDEV-14222 Unnecessary 'cascade' memory allocation for every updated row * MDEV-15219 - FOREIGN KEY CASCADE or SET NULL operations will not resume after lock wait * MDEV-15042 - INSERT ON DUPLICATE KEY UPDATE produces error 1032 (Can't find record) * MDEV-13205 - InnoDB: Failing assertion: !dict_index_is_online_ddl(index) upon ALTER TABLE * MDEV-14958 - Merge new release of InnoDB MySQL 5.7.21 to 10.2 * MDEV-15165 - InnoDB purge for index on virtual column is trying to access an incomplete record * MDEV-15143 - InnoDB: Rollback of trx with id 0 completed * MDEV-11415 - Remove excessive undo logging during ALTER TABLE…ALGORITHM=COPY * MDEV-15016 - multiple page cleaner threads use a lot of CPU * MDEV-14941 - Timeouts on persistent statistics tables caused by MDEV-14511 * MDEV-14985 - innodb_undo_log_truncate may be blocked if transactions were recovered at startup * MDEV-14441 - InnoDB hangs when setting innodb_adaptive_hash_index=OFF during UPDATE * MDEV-14887 - On a 32-bit system, MariaDB 10.2 mishandles data file sizes exceeding 4GiB * fixes for the following security vulnerabilities: * CVE-2018-2562, CVE-2018-2622, CVE-2018-2640, CVE-2018-2665, CVE-2018-2668, CVE-2018-2612 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10213-release-notes/ https://mariadb.com/kb/en/library/mariadb-10213-changelog/ * fixes [bsc#1058729] and [bsc#1068906] - refresh mariadb-10.2.10-disable_openssl_compatibility_check.patch - refresh mariadb-10.2.3-group.patch- add dependency on which for galera scripts- change owner of mysql-test directory from root to mysql. It also fixes sys_vars.secure_file_priv running under mysql user (e.g. if ít's started via suse-test-run script) that needs to be able to create a test file there during its run [bsc#1012075]- update to 10.2.12 GA * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10212-release-notes/ https://mariadb.com/kb/en/library/mariadb-10212-changelog/ - remove mysql-community-server-5.5.6-safe-process-in-bin.patch becuase this moving is done in the specfile - get rid of the archive with patches (remove mysql-patches.tar.xz and series files), handle patches in the standard way mysql-community-server-5.1.45-multi-configuration.patch mariadb-10.2.4-logrotate.patch mariadb-5.5.28-install_db-quiet.patch mariadb-10.1.1-mysqld_multi-features.patch mariadb-5.2.3-cnf.patch mariadb-10.2.3-group.patch mariadb-10.1.12-deharcode-libdir.patch mariadb-10.0.15-logrotate-su.patch mariadb-10.2.4-fortify-and-O.patch mariadb-10.2.8-systemd-cmake.patch mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch mariadb-10.2.9-galera_cnf.patch mariadb-10.2.10-disable_openssl_compatibility_check.patch - add comments to the section with removing unused files (based on https://lists.launchpad.net/maria-developers/msg11028.html) - put rm statements together - install the new upstream systemd-tmpfiles configuration file 'tmpfiles.conf' and rename it to 'mariadb.conf' in order to follow the manual - remove the new upstream systemd-sysusers configuration file as we handle creating of mysql user in the specfile - mysql.service: remove calling of the wait function and let systemd to do this job. Switch from 'Type=simple' to 'Type=notify' and add TimeoutSec=300 - rename unit files from mysql to mariadb and add mysql alias for the backward compatibility [bsc#1067443] * mysql.service -> mariadb.service * mysql.target -> mariadb.target * mysql@.service -> mariadb@.service - remove configuration-tweaks.tar.xz and move configuration to my.ini/my.cnf file (omit default_plugins.cnf as all configuration here was commented out) - add a numeric prefix for galera.cnf file in order to allow users to speficy in which order the configs will be loaded within the my.cnf.d directory [bsc#1055268] - add 'bind-address = 127.0.0.1' as a default option to my.cnf file for security reasons (disable MariaDB to listen for TCP/IP connections by default) [bsc#1058374] - update my.cnf file and add a section with SSL configuration [bsc#1058374]- switch from deprecated 'net-tools' to 'iproute2' for mariadb-galera subpackage. This dependency switch is sufficient for making wsrep_sst_rsync.sh script to use 'ip' instead of 'ifconfig' command- Do not manually delete %{_localstatedir}/adm/update-messages/%{name}-%{version}-%{release}-something: The file is listed as ghost and thus properly owned by the package. - Use %tmpfiles_create which can cope with transactional updates.- update to 10.2.11 GA * release notes and changelog: * https://mariadb.com/kb/en/library/mariadb-10211-release-notes/ * https://mariadb.com/kb/en/library/mariadb-10211-changelog/ - pack additional mroonga/groonga files - change default charset to utf8mb4 for full Unicode support [fate#324329] - remove mariadb-10.2.10-wsrep_sst_common.patch as it's no longer needed- Added mariadb-10.2.10-wsrep_sst_common.patch (bsc#1069401). Upstream bug: https://jira.mariadb.org/browse/MDEV-14256- Disable openssl compatibility checking * the check uses CRYPTO_set_mem_functions() to set debugging memory allocation function. The setting only succeeds if no allocation was done before. Our fips self-tests, which are run from the library constructor, however, do allocate memory, so the subsequent call to CRYPTO_set_mem_functions causes the compatibility check to fail * add mariadb-10.2.10-disable_openssl_compatibility_check.patch- update to 10.2.10 GA * release notes and changelogs https://downloads.mariadb.org/mariadb/+releases/ * fixes for the following security vulnerabilities * 10.2.10: CVE-2017-10378, CVE-2017-10268, CVE-2017-15365 * 10.2.8: CVE-2017-3636, CVE-2017-3641, CVE-2017-3653, CVE-2017-10320, CVE-2017-10365, CVE-2017-10379, CVE-2017-10384, CVE-2017-10286, CVE-2017-3257 * 10.2.6: CVE-2017-3308, CVE-2017-3309, CVE-2017-3453, CVE-2017-3456, CVE-2017-3464 * 10.2.5: CVE-2017-3313, CVE-2017-3302 * [bsc#1042632], [bsc#1043328], [bsc#1019948], [fate#323738] - refresh and rename the following patches: * mariadb-10.1.4-group.patch to mariadb-10.2.3-group.patch * mariadb-10.1.16-systemd-cmake.patch to mariadb-10.2.8-systemd-cmake.patch * mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch * mariadb-10.1.12-fortify-and-O.patch to mariadb-10.2.4-fortify-and-O.patch * mysql-community-server-5.1.46-logrotate.patch to mariadb-10.2.4-logrotate.patch - add mariadb-10.2.10.tar.gz.sig signature and mariadb.keyring files - start building without client library part, use mariadb-connector-c for getting libmariadb libraries. Remove libmysclient* packages - remove baselibs.conf because we no longer build client libraries here - update %{soname} to 19 (libmysqld soname) - change '=' to '>=' in Requires:mariadb-errormessages for libmysqld%{soname}. Versioned libraries shouldn't require regular packages with '='. It also causes problems during update (Problem: libmysqld18-10.1.25-3.1.x86_64 requires mariadb-errormessages = 10.1.25, but this requirement cannot be provided). Also add "Provides: mariadb-errormessages = 10.1.25" for errormessages subpackage that solves this problem for the current update. - pack new files, remove mysql specific files - remove README.SUSE as it was outdated - package cleaning * run spec-cleaner * renumber sources * reorganize subpackages order and update summaries, descriptions and groups * tweak and add some comments to the specfile * remove warning about mysql-packaging repository that is no longer used for this package * remove checks whether we build mysql or mariadb (we build mariadb only) - add galera subpackage * add missing "Requires:" (lsof, net-tools, rsync, socat, xtrabackup) for proper wsrep scripts functionality * add mariadb-10.2.9-galera_cnf.patch that enhances galera.cnf configuration file (add wsrep_on=OFF and set the location of the wsrep library) * rename README-wsrep to README.wsrep so it corresponds with the other README names * move galera_new_cluster, galera_recovery, use_galera_new_cluster.conf, wsrep_* scripts to the galera subpackage - remove the following macros definitions: * %{_tmpfilesdir} - it's been defined in systemd macros since openSUSE 13.2 * %{preferred} - we no longer need to distinguish between preferred and not preferred version (we build mariadb only) * %{with_mandatory_lz4} - mysql specific * %{build_extras}, %{pretty_name}, %{build_readline}, %{builtin_plugins} and {libname} - they are no longer needed - add the following macros * %{run_testsuite} macro that controls the run of the regression testsuite * %{ignore_testsuite_result} macro - when set to 1 it ignores results from the regression testsuite (debug purposes) * %{with_mroonga} macro (enable mroonga build for x86_64 archs only) - rename %{with_jemalloc} to %{with_tokudb} and enable tokudb for x86_64 architectures for openSUSE and SLE15 [fate#323280]. Don't enable it for SLE12 (missing jemalloc dependency) - add the following BuildRequires: * unixODBC-devel to allow ODBC support for Connect engine [bsc#1039034] * krb5-devel to build auth_gssapi.so plugin * libarchive-devel * use libboost_headers-devel instead of boost-devel for TW. Boost package has been split up and will migrate to using multibuild. This results in packages that unnecessarily build require boost-devel to cause major bottlenecks [bsc#1062583] - do not use "BuildRequires: lzo-devel" for i586 and arm because it makes build fail - add the following Requires: * hostname - as mariadb_install_db depends on this tool [bsc#1060110] * libaio-devel for libmysqld-devel because libmysqld depends on libaio - tweak build options: * remove "DWITH_ASAN=OFF" - this option was added because of mysql and it's no longer needed * switch from "-DWITH_JEMALLOC=auto" to "-DWITH_JEMALLOC=system" * use "DCMAKE_SKIP_INSTALL_RPATH" - this allows to link with -rpath during build and fixes quite a few test suite failures. When installing the file -rpath is still disabled, so this should not have any effect on the installed binaries * add "-DWITH_LIBARCHIVE=ON" and "-DWITH_MARIABACKUP=ON" * remove -DWITH_BOOST=../boost/ as we use system boost now - enable OQGRAPH to build (openSUSE only, SLE is missing Judy requirement) - disable Cassandra storage engine build as it's no longer actively being developed (See MDEV-4695) [bsc#1055165] * Remove "BuildRequires: libthrift-devel" and %{with_cassandra} macros that are no longer needed now - disable make test (Connector/C unit tests) as it requires a running server. These tests are part of mysql-test-run now (MDEV-12470) - add suse_skipped_tests.list - the list of the tests that we want to skip (they fail correctly or the fix is in progress) * adjust mysql-test-run options to skip tests listed there [bsc#1041891] - remove mytop utility that is packaged separately - remove *.jar files from mysql-test - remove python scripts remains from tokudb upstream - remove generating of the MySQL NDB Cluster filelists - remove removing of manpages for MySQL Carrier Grade Edition - provide a symlink for the my_safe_process executable that was moved from its location to bindir - update filename in /var/adm/update-messages to match documentation and build-compare pattern - README is now README.md - fix "file listed twice" build error- Also Require: libopenssl-1_0_0-devel from the libmysqlclient-devel package- Drop INFO_BIN from package because it is not needed and differs for every build (boo#1047218)- Explicitly require libopenssl-1_0_0-devel, to successfully build once we switch openssl to 1.1 (bsc#1042632)- update to MariaDB 10.1.25 GA * notable changes * MariaDB can no longer be compiled with OpenSSL version 0.9.8 and below. The last 0.9.8 release was in December 2015, it is out of support and is no longer getting security fixes. * MariaDB Backup is now beta * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10125-release-notes * https://mariadb.com/kb/en/mariadb/mariadb-10125-changelog * refresh mariadb-10.1.12-fortify-and-O.patch * remove mariadb-10.1.22-xtradb_null_checks.patch (MDEV-12358), a fix was merged upstream * update file lists for new man-pages and tools - switch from 'Restart=on-failure' to 'Restart=on-abort' in mysql.service in order to follow the upstream- Add mariadb-10.1.22-xtradb_null_checks.patch (boo#1041525) (See also https://jira.mariadb.org/browse/MDEV-12358) - switch from '/var/run' to '/run' as /var/run is just a symlink to /run - fix permissions for /var/run/mysql that were wrongly set to 700 instead of 755 due to added umask. This prevented non-root from connecting to the database [bsc#1038740] - change permissions of the configuration dir/files to 755/644. Please note that storing the password in the /etc/my.cnf file is not safe. Use for example an option file that is accessible only by yourself [bsc#889126] - set the default umask to 077 in mysql-systemd-helper [bsc#1020976]- increase required physical memory in _constraints from 5 GB to 7 GB in order to try to fix i586 build that fails because of "Out of memory" error- update to MariaDB 10.1.22 GA * notable changes * XtraDB updated to 5.6.35-80.0 * TokuDB updated to 5.6.35-80.0 * PCRE updated to 8.40 * MDEV-12160: ed25519 authentication plugin * MDEV-11842: Fix a 10.1.21 regression with failed INSERT, BEFORE INSERT triggers, and columns with no default value * MDEV-12075: Fix a 10.1.21 regression in the InnoDB data file extension code * MDEV-11027: better InnoDB crash recovery progress reporting * MDEV-11520: improvements to how InnoDB data files are extended * Improvements to InnoDB startup/shutdown to make it more robust * MDEV-11233: fix for FULLTEXT index crash * MDEV-9734: systemd compatible bintar files now available * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10122-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10122-changelog/ * fixes the following CVEs: * CVE-2017-3313 [bsc#1020890], CVE-2017-3302 [bsc#1022428] - refresh mysql-community-server-5.1.46-logrotate.patch - refresh mariadb-10.1.16-systemd-cmake.patch - remove mariadb-10.1.20-incorrect_list_handling.patch that is no longer needed [bsc#1022428] [CVE-2017-3302]- update to MariaDB 10.1.21 * notable changes: * Innodb updated to 5.6.35 * Performance Schema updated to 5.6.35 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10121-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10121-changelog/ * fixes the following CVEs: CVE-2017-3318 [bsc#1020896], CVE-2017-3317 [bsc#1020894], CVE-2017-3312 [bsc#1020873], CVE-2017-3291 [bsc#1020884], CVE-2017-3265 [bsc#1020885], CVE-2017-3258 [bsc#1020875], CVE-2017-3257 [bsc#1020878], CVE-2017-3244 [bsc#1020877], CVE-2017-3243 [bsc#1020891], CVE-2017-3238 [bsc#1020882], CVE-2016-6664 [bsc#1008253] - add mariadb.te file to the filelist - add mysqld_safe_helper to the filelist - refresh mariadb-10.1.4-group.patch - add mariadb-10.1.20-incorrect_list_handling.patch to fix incorrect linked list handling in mysql_prune_stmt_list() function that can cause use-after-free error [bsc#1022428]- Replace systemd and systemd-devel BuildRequires with pkgconfig(libsystemd), which matches what the build system is actually looking for.- update to MariaDB 10.1.20 * notable changes: * XtraDB updated to 5.6.34-79.1 * TokuDB updated to 5.6.34-79.1 * HeidiSQL updated to 9.4 * The limit for the table_open_cache system variable has been increased to 1024K * Galera wsrep library updated to 25.3.19 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10120-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10120-changelog/- update to MariaDB 10.1.19 * notable changes: * XtraDB updated to 5.6.33-79.0 * TokuDB updated to 5.6.33-79.0 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10119-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10119-changelog/ * fixes for the following security vulnerabilities: CVE-2016-7440 [bsc#1005581] CVE-2016-5584 [bsc#1005558] - add mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to fix mysql_install_db.sh script to find data files in mariadb directories when a user uses "--basedir" option [bsc#1006539] - switch to xz compression instead of bz2 for the following tarballs: * mysql-patches.tar.bz2 renamed to mysql-patches.tar.xz * configuration-tweaks.tar.bz2 renamed to configuration-tweaks.tar.xz replace occurrences of "bzip2" with "xz" in README.debug- update to 10.1.18 * Release notes: https://mariadb.com/kb/en/mariadb/mariadb-10118-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10117-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10116-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10115-release-notes/ * Changelog: https://mariadb.com/kb/en/mariadb/mariadb-10118-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10117-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10116-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10115-changelog/ * fixed CVE's: CVE-2016-8283, CVE-2016-6663, CVE-2016-5629, CVE-2016-5626, CVE-2016-5624, CVE-2016-5616, CVE-2016-3492, CVE-2016-6662, CVE-2016-5440, CVE-2016-3615, CVE-2016-3521, CVE-2016-3477 * fix: [bsc#1005582], [bsc#1001367], [bsc#1005569], [bsc#1005566], [bsc#1005564], [bsc#1005562], [bsc#1005555], [bnc#998309], [bsc#989926], [bsc#989922], [bsc#989919], [bsc#989913] * refresh mariadb-10.1.4-group.patch * refresh mariadb-10.1.12-fortify-and-O.patch - requires devel packages for aio and lzo2 - remove mariadb-10.0.21-mysql-test_main_bootstrap.patch that is no longer needed [bnc#984858] - append "--ignore-db-dir=lost+found" to the mysqld options in "mysql-systemd-helper" script if "lost+found" directory is found in $datadir [bnc#986251] - remove syslog.target from *.service files [bsc#983938] - add BuildRequires: systemd-devel - make some dependecies switchable - add systemd to deps to build on leap and friends - add mariadb-10.1.16-systemd-cmake.patch to allow more (case-insensitive) values for 'WITH_SYSTEMD' variable in systemd.cmake - replace '%{_libexecdir}/systemd/system' with %{_unitdir} macro - remove useless mysql@default.service [bsc#971456] - replace all occurrences of the string "@sysconfdir@" with "/etc" in mysql-community-server-5.1.46-logrotate.patch as it wasn't expanded properly [bsc#990890]- update to 10.1.14 * What is MariadDB 10.1: https://mariadb.com/kb/en/mariadb/what-is-mariadb-101/ * CVEs fixed in 10.1.x branch CVE-2016-2047, CVE-2016-0668, CVE-2016-0651, CVE-2016-0650, CVE-2016-0649, CVE-2016-0646, CVE-2016-0644, CVE-2016-0642, CVE-2016-0641, CVE-2016-0640, CVE-2016-0616, CVE-2016-0610, CVE-2016-0609, CVE-2016-0608, CVE-2016-0606, CVE-2016-0600, CVE-2016-0598, CVE-2016-0597, CVE-2016-0596, CVE-2016-0546, CVE-2016-0505, CVE-2015-7744, CVE-2015-4913, CVE-2015-4895, CVE-2015-4879, CVE-2015-4870, CVE-2015-4866, CVE-2015-4864, CVE-2015-4861, CVE-2015-4858, CVE-2015-4836, CVE-2015-4830, CVE-2015-4826, CVE-2015-4819, CVE-2015-4816, CVE-2015-4815, CVE-2015-4807, CVE-2015-4802, CVE-2015-4792 * adjust mysql-patches.tar.bz2 archive for mariadb-101 * pack new MariaDB 10.1.x files - remove '%define _rundir' as 13.1 is out of support scope - temporarily disable OQGraph It seems to need the boost library with the version not earlier than 1.40 and not later than 1.55 (MDEV-9479) - add "BuildRequires: systemd-devel" for SLE12, openSUSE 13.2 and openSUSE Leap in order to enable systemd features during the build of mariadb-101 for these products. Otherwise we get "Performing Test HAVE_SYSTEMD - Failed" and systemd files aren't installed. - re-enable profiling support - don't remove HandlerSocket plugin [bnc#979524] - add 'log-error' and 'secure-file-priv' configuration options (added via configuration-tweaks.tar.bz2) [bsc#963810] * add '/etc/my.cnf.d/error_log.conf' that specifies 'log-error = /var/log/mysql/mysqld.log'. If no path is set, the error log is written to '/var/lib/mysql/$HOSTNAME.err', which is not picked up by logrotate. * add '/etc/my.cnf.d/secure_file_priv.conf' which specifies that 'LOAD DATA', 'SELECT ... INTO' and 'LOAD FILE()' will only work with files in the directory specified by 'secure-file-priv' option (='/var/lib/mysql-files'). - run 'usermod -g mysql mysql' only if mysql user is not in mysql group. Run 'usermod -s /bin/false/ mysql' only if mysql user doesn't have '/bin/false' shell set. - don't delete the log data when migration fails- fix constraints conditions for 32bit architectures- fix information leak via mysql-systemd-helper script [CVE-2015-5969], [bnc#957174]- update to 10.0.22 * Release notes: https://kb.askmonty.org/en/mariadb-10022-release-notes/ * Changelog: https://kb.askmonty.org/en/mariadb-10022-changelog/ * fixed CVEs: CVE-2015-4802, CVE-2015-4807, CVE-2015-4815, CVE-2015-4826 CVE-2015-4830, CVE-2015-4836, CVE-2015-4858, CVE-2015-4861 CVE-2015-4870, CVE-2015-4913, CVE-2015-4792 * remove the following patches (applied upstream) * mysql-community-server-5.6.12-srv_buf_size.patch * mariadb-10.0.16-header_files_const_warnings.patch - add mariadb-10.0.21-mysql-test_main_bootstrap.patch that fix main.bootstrap test (change default charset to utf8 in test result) [bnc#937787] - add mariadb-10.0.22-fix_build_denabled_profiling_off.patch to fix compilation with '-DENABLED_PROFILING=OFF'- update to MariaDB 10.0.21 * changes: * https://mariadb.com/kb/en/mariadb/mariadb-10021-release-notes * the following patches were processed upstream and are no longer needed: * mariadb-5.5.28-hotcopy.patch * mariadb-5.1.50-strncat-overflow.patch * mysql-community-server-5.1.51-mysql_config.patch * mariadb-5.5.32-upgrade-exit-status.patch * mariadb-5.5.41-mariadb-admincrash.patch - use syntax in mysql-systemd-helper that is accepted by both mariadb and mysql [bnc#937767] - fix spurious macro expansion in comment in specfile - install INFO_BIN and INFO_SRC, noticed in MDEV-6912 - replace readline-devel for readline5-devel (MDEV-6912) [bnc#902396] - use spec-cleaner - Tweak some cmake switches to enable more things * WITH_ASAN=OFF adress sanitization WITH_LIBWRAP=ON tcp wrappers ENABLED_PROFILING=OFF profiling disable (for mysql) ENABLE_DEBUG_SYNC=OFF debug testing sync disable (for mysql) WITH_PIC=ON by default we want pic generated binaries (for mysql) - set cmake options for MariaDB Galera Cluster - remove superfluous '--group' parameter from mysql-systemd-helper - make -devel package installable in the presence of LibreSSL - cleanup after the update-message if it was displayed - add 'exec' to mysql-systemd-helper to shutdown mysql/mariadb cleanly [bnc#943096] - remove redundant entry from %{_tmpfilesdir}/mysql.conf. Using both 'x' and 'X' options is redundant and causes a warning message. Leaving only the 'x' line fixes this problem. [bnc#942908]- Sync to git state, fixes bnc#937754 too- Sync to git state fixing few triv issues- Enable testsuite- Update to 10.0.20: https://mariadb.com/kb/en/mariadb/mariadb-10020-release-notes/ * Fixes bnc#934789 Logjam Attack using 512bit dh groups in ssl - Sync the package to git state, redoing initscripts to be more robust- Update to 10.0.19, sync to git state of repository: https://mariadb.com/kb/en/mariadb/mariadb-10019-release-notes/- fix parent directory has insecure permissions error- disable optional features for mariadb * still possible to use them from mariadb_100 package- Adjust _constraints. 11GB is not enough for ppc64 builds, increase to 13GB- fix build for openSUSE 13.2 ppc bnc#921955- Updated to the version 10.0.17 * Release notes: http://kb.askmonty.org/v/mariadb-10017-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10017-changelog - merged patches to packaging git and regenerated * few fixes mainly to upgrades- README.SuSE is now README.SUSE; fix name in some places.- Fix undefined initial status in systemd script (boo #914370)- Fix include dir in alternative cnf files (bnc #859345)- run spec cleaner on spec - update to 10.0.15 * Release notes: http://kb.askmonty.org/v/mariadb-10015-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10015-changelog - conditionally enable more storage engines - updated packaging to the latest templates- fix bashism in posttrans script/bin/shmysql-clienth04-ch2a 1695155996  !10.6.15-150400.3.29.310.6.15-150400.3.29.310.6.15-150400.3.29.310.6.1510.6.15mysqlaccess.confmariadbmariadb-adminmariadb-checkmariadb-dumpmariadb-importmariadb-showmariadbd-safe-helpermysqlmysqladminmysqlcheckmysqld_safe_helpermysqldumpmysqlimportmysqlshowmysql-user.confmysqlplugindialog_examples.somariadb-admin.1.gzmariadb-check.1.gzmariadb-dump.1.gzmariadb-import.1.gzmariadb-show.1.gzmariadb.1.gzmariadbd-safe-helper.1.gzmysql.1.gzmysqladmin.1.gzmysqlcheck.1.gzmysqld_safe_helper.1.gzmysqldump.1.gzmysqlimport.1.gzmysqlshow.1.gz/etc//usr/bin//usr/lib/sysusers.d//usr/lib64//usr/lib64/mysql//usr/lib64/mysql/plugin//usr/share/man/man1/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:30339/SUSE_SLE-15-SP4_Update/ab0091404d14e741bd181ce92145794a-mariadb.SUSE_SLE-15-SP4_Updatedrpmxz5x86_64-suse-linux ASCII textELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=dccd83bb1149814300ccc4531a8c2fc71f98a143, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=313e7620e03360ca0d1a918b6ae19fcf578ca171, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=8cc6513a6fe4280a8b787ade03303702575d22f7, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=407f96afab997d63c294871d6ecaa0db5f508e20, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=a50eeefee4afd00a4b9e0d1f5e826d7cd000882d, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=e100ca7c61ce9ea11e7aceef0ce1ecad5fb49e31, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=665121030fe78050234e7526a609e978a9f31089, for GNU/Linux 3.2.0, strippeddirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fa7615aa7fcf4bcf8a014d5b0cfc8dadaec1078b, strippedtroff or preprocessor input, ASCII text, with no line terminators (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)0CVi| RRRRR RRRRRRRR RR RRRRRRR RRR RRRRRRRR RRR RRRRRRRRR RR RRRRR RRR RRRRRRRRR RR RRRRR RRR RRRRRRRRR RR RRRRR RRR RRRRRRRRR RR RRRRR RRR RRRRRRRRR RR RRRRR RRRRRPPRR RRL| ;@RUN y/C)( (EzH~NOt^85[v#Ԓ_ekn9I%~M~_6=2裩ܹG. 4 ld.q60<(F W:/sT|쨕-V;L\FL/.CF+1Ϊ$8S"C"bEAxS29e qs{+aBƲ^?r4NڸOR,q,QCRعJ³דn;VjW,^ gO|w&bQ䶞'?>T G6ɾhL0 9g\GU%DWaS2g HӫS sCMګ h\o_dEُ ˬ2sLT. C0$8vPc&pM=1 ( |>;~o[r5Z\="py[_ub+8IO#+NXD+ e"eD?li,PQ(fo҄)%8GP>gazmbl\ZY\wYmk9Vax&x$x 934`mNx|+Z?Q*k>!/ iΡ?d`F]iscrkuHh-V6V_R|x㈠Zd#qP٣մ:%KqH\>g$ncVe8pG}aC=yu4~O4@Y֦?Lէ4@+H}&V"&Zn4ƊP i+/MXrsuJ[eeDJYz0T1 $hBueEQ.N]-W/׼D‘_">[.j%:FQV(" "ah $׹Edd[zTcBUhGKy`h7_2N]]웹5Ǥ2?NڎbNl~0d65O$|meF`PLG Ao.L+ߑ $|&JP"F~u) ș n: nh0.4D:ӋjR*u )IuXv]ɓ9 C*4a6iTHq~9+ҲJSmS '،ԊmA-;xVs߳E2Ѱ*S*-6LR[RL W7Ǝ͋XB+,!Ya94b5nUHS%<&6ġ{t]Sظb cıX(wcPl g"r+Iy_^vԋOU$3%i]*F ?P/;`M.qU:8ë[м؂k'h^J/}~OCWp$fs+dSĹ^*0  XJΔx2=nc6*%:""i< rF"eܷ:9*W HjA4h^Cu'Da=j5 ?ۘGrz90{A[fƮp~0GjaQ$(*0Q#+We/Z\#>JGpm2NoҎ7׽EnPR p?{^%p 2r.gPOzD8CmTtaZCjʺH~`Zf q/A\RG3bH29 K9ez>>KM>'p\ imEu.w6 n^s|x7)W:C. DIc kQ_G+š? 6/FgoMDIaNqAt=`$Oc$C"a%cSJ̥m "*u90!oz1@钀nVMvhFxp9`d&+nUрBrhVK4e-5lUѠa%QU'OOnKĸLn*8Q KOk~([ğwϋS3pqV:E8(FZYV$N~9C( LOSZr4O\ vn<h`؞QV]>1}MZD.'-OS$O$!hw_ʹ&n(d?n-[~XD>wilMay*x)m>tk udU04,h͗}yBuB4~(0w>eϭ,Pc{uR.nm\=RfumT$jQc޽j;G i7dX{"&J;V~CݗFUK?&A a,;zCN]] xM*.rT\t\VȖ)W.Wasq,:¢^1Q!bX ] }KİKyYE nf#ʕ䢹vX{r:TfI"*+]MՍ07A! nXWxf66Vx::<zAYθg_}-g@ȑ*13Z,@.5|<=ɶ?5f=œNRXJ)%%M>7D8„榪 4h|,; ::gyeƈ^:يx7An5b F]Rm$sDRY5S!Gl0g%$ h٣iqK.oFry`f7&L'5YeD0(=/bb˻1v3YǿISCy*{^IcJnkWG[z-&ϡ<)y#(:a]dϪvlMs`m4`aD1հf qWF!ӷM%7oc>Ei52`AV (" $-߳Т~W7ǘ贿Kp;$N4 7jѠr>o\uo@(:c2 6H&a~8e&PrDxiFԯ{wΫL#j^DLFJ]x!~=gP2؝%j$ll:#T)!ԏH?.(uEq=ԯx]R= N[(UC QS>ԯfiDRt(˫8'ZSYZ-H%ZQ`} '=5Y=t6anX[ CAsOs/< ߧ~^fߕL_AF)~Ç*\2=faĖv[~PZQ$*6|Pkqgyl84]P96BWiߎc7U1hX:t3;sKRg +kADwuɭs(I„Czƀx:z.ȇ>nB(σRd \9H\c+]q&D@ w?8LNUo91FP,ޡOA쫫Ct} rh{P6A6JC]YbHG uMA~]z/'Ъ_Ĩ?i&C2v`s|3- ~4INY :dTF&;^mA ֑>ّԛ8ԏ) OiB)a 1o_=4p#F0ٕ9 &3]O?R4,w,1-zoiĹ/P'j\AپJCcX񞑑3DKT~amu_( v|BH.#/ ME |3;}:UsVC7`GrmyZ%)-j>glyw*7hgW5^6nox!#g+1ݲB۾Ar۸ Z\ڕɁPzE;8Hx>sY=i2"\cCϵ Pq\yu5{] zu3ܻ;VZ\{^&%,.7@Oy_fN'2CF(6M="nN OpKu!:? o&`q>q_]M/LJ%]|mVބz0K"dlbK'IH/8DmXO6u*$;%b}3]2 UL"aS7xQ]GЂ  dEhK m<[aAtG96~X +ERl#%"v~#V5 wEIP7~=6 H,3 Z EtuGh1aW::$zW'aQ$ƚnT:?T`Z^odNB@6Y@L#Bte]1Z7POnCto'fS=ԩ/mcXepa' a ]c[uo(h:Jf|$Y=;A J8p'@!_JB7Rȭ R+4|u*7-YX|Gp' ^: bEcW{?"j("6Qm8;0"av;!O[{ɝ 0 #:W3wqFЋe5l W:8]ē7RmI|ם*66Aw;MvMIpW/ydR!YPNB}j'J>@GYEpI!<rhrJ}¿XEZʍNrg -H1mdNEoP?$ܲrbqD1[ ׮H1}|;8&Nͩ9+ h\/u/vNCZPl(H F5o"r"4c9^jō%`| Byt5C@\^tߓ&q4"UA6SًVԁJXশ;KEA<^ , ۖQz|Ζ1k{癗Đ=ݶ} \ÊcpW`(^7r:&mhFGNrw듂=O4:CJjaB]0u[;%+~ 4ڳ]{uo)ۙ}'5^& ^iDrY`ՁjFo\uAQ]y籨[3%|^mLiS$'M@&EXmw/~~̸Үjo4&m޶ikJO:@{=7}ǃ\NTmaa$ȸƧ;f"E GĘ !:Mb 0WJuʠEoe'+#[>i`h_b#UUKFw":QZt3nW#Vf ldB-uԙqIF@DGGzrŒ  ydmlfRzh@  }]S% !]=Yn;m!s[KOraIbWcm9e"~3tq`P9?7f-LB'㊕MTFA'Jgo$,ܣO1鷴QɐFCNI}S5P[%"Il92qyKhTK=\l'^?kF h+"Y9D0CPA""Ms!/C"Opݥw qF{8~|O{lp*y tr[aeȺW2`1Au NF+t}gG50bv]A _~?(NVbWo 'HY /5-@6i6yW53!&cN?X:x<GLՓ TPAѢYmS,ikO8L*?Wy\;Lr.gո 1BJ|ɻOH1Ktke/&xg:856 m%G֯Me}vnԿx )ѳY)Lx:Fho:F ܹ/ ̔˸#~n@T[|e﵌M1,lBT Q)qfd)[/S鞉"g^RJZqSSah o$!pXcSbX?>!QN={ơٶaPԸe֟Yri`H~X&>X>k[xS=Q |k&@`yju ~iG#"Kfs s'+2'zTQȲ KoiG𹵂[Z$qyp̕+JDR-o{g~_gȧ "EIY7kg"eSWOyoӓgG%pab'Ԩ$pYz/æ2Q"l}Ҝ胂 25sF 4Č}ז 1H@Ze/Bg1H6f5$p!dW %+ fٓ <A+StP,Mp[Qdyk S<95{' [:8ϢxC%sLfҭ=`:--7/+"kT <Ĉ\s4nhތBɝ]却]E-&fy}.ԅM/5HGXS˥2n{|Z󟱰4áGPqg$ H!|z*H~_P>%uw5Ldt{48|fRY/!sFE]"uwQӲg &4(6xhe$bɽGeIpp6ZXn%]Fp4swT'krX=*!$^S k$5ӀŽn9ev;. lI˭-0BEyHʼn`4(+2B 22׍[o.)0b4*Ά|DsA9kd` ؠ6'}Ng.AptR+U N\閪1O\mtV۔Xnvy>e2ԣhof\D "Mԗ^ɽ1EϬKrtkUr; t gCǺJ$Q%P"oԆtJS )-v"u~gd@ W'yE]k1c7y/I}'3rZhq3 p|Cz?·2I~: ݪMpDgi/&E0DLC]id++H6qƮNxPI)@_:8;=fJ=Pa 5ږK_4ůsIfUD/˷̏Ss>!Z{jQ NCIY a4:}@c+I&Ef.+6qb oӵx<'^d1hQ?مw3n % >]1Nl,~" 0hDԭ+eQMfRd >QBiVFωR)*iD9vr]-P?@#)Ç 2(I"ȳ֮jA{Û vQ=|& ;F hRpmLaβϹ?ÆddWLIWM(yM%T$iz4@BT̙+cC,uFK62;j /LuSR !Cvb;=R 2T #9.H([v?Ǻ [)Ul1XZafi ۳@PJZ. Enj$b3/tlsxc`q\"rqDz-Ѝ"rjG]j x6CESN\R/p(_:b,,,ՐYHSݮ31eN q;΢ HST.ĝrKGd{tvD)T(Ռ0o$t"fs(t`YTKj qd3SdHLSI!E$\&Rx_X<ځHEnV0ù&],rSIF=9w.5 gNKn9:Q@+x. ek%kVm5RX~F> d#JjrKI|\Yj0FN^pφQO%_Ȥ #x@SdHhڕx$}+8LpaEcHB!e<+́]6g%4OOw-tR= ʌd!cI\>P8@FqT0:P5 9 3;{OAiOVus@7,[$,c/@V-ԨZҘ-QVU(heg:I$$mU鞚IG4.Sntօ\|x:i st~N(LG4\)@ fҶXCVZ{Ԡ g&'=^蠁(vk䈧-X2`|~k.VPc Dswd4SΫ55M>n½$mqi6Y_7zwi/]ucSBU^N}=,-yʏvXg9 J̑æa5.0&*۞.Ld'15݁O+T}]M-<$줘'x\R9"֜B9sXԺq*{di\I{U!Y׍ OXe39+;IN$tç; KTy\hyAW 4@Ė2*?䗭-n&#o [~k@|p:L6 SbhC=]iau0MlA,te//eCW`狵=M̍ ]5;S]^ø#*D^n⟿> "8{.bߐ1PXU,fG7#*l2BH<~?r&Vl~T5lHr,8&ݼ*URJ_u~s~${j(Jd<5ML3Q6س~ Z 7 u)+<,`d*?o?Ǜ~&PRVi/n8+ED@{5ʩsp|.qIKf5,guS1j.~I D}!a1\mcxf==dT IPfCj!jj\:c%t(PX[cQ?A6$Y2:K?a\ kA2'h㖄_)wjjX!YwM_ eJ2@X/bl{\)):y3ǹ<~39@{SUa(c@ClY#?3levSoɔIX_XrHh,bKPb UR [.Iz9cQ`)ƹNwPܴR)+)*"m ?Xh~O.D#ZＲgFkq#x$u⑼FP@Ndʪ{Kz4GLvVMa^"TE Th >mQk+dł7fI)͖Hk3W Pk 6Tf G(D4z&z+Yφl{/󄤌߲ wTܖ_d XuC~Yٸsi"EuHqjn(t|*LTS^8k6] />*a\:f·)Iqh쏣~p^Qn;'l? :W@v\pdz یBZ&0:~ f.ld |)QVN0+B D'h[O^ Ȋ'"aiC) 舸% Ғ IAٯ[am'-BHxyڕv9ѻ+>ܡ5'KsVv'ʑ RC; ;(H5h92=I&F7&S q8:Q8N[ђAo9{xdGM={bU{)F(.z(܎x2"}թL5y EηllW(MPzQb?:l@axb` n+0T$`u3jg.G } c ;|J uV-~Gy=YvM(04"cP8Pn+(M/y 䱍ҥg)/36-4bMilY*7I ")H (vyV j,W}ql]PW48Ft;K'[٬>Agsdup˳=BMs&.cgWMH[7Ք.d)\xҎ{ tXа$,.Gp"泏 CӖUu?EK܁mG$p?䤺Y,I NsFe<7d_TŠ?Ŕ'G5 Mp*Gp¤=ӓb"dS $2m2eAo{C HاΨ= ׏(1&^nwot $х5/gS `qͩ㭉TX5KGMWr|3{:Ԙy.>pC $Pp.y \f&tⓑS37`)~,KLD _3:rl{b#ԗZ@uZ1d4^͜ ȷ1sY9d Du\-]ՈR,jtpOƺ= C)_kSl!_ |I W"ϕ=Hlul3{tPP)}Sr&ETGDG9瘚NJV_$ۘmVǙ- 1ςT+nn`h+{kO|9j|!aйǸNzI %c''/~>"^Q@sP?Bʄ?mm~SS~-8œԉ tVFڎ]|]]9НG?0%%‡:E P#non:q7*8d$+9n `%Opo]O*mO<ל?3 0QJfh8tCBP0TWȰ?ڃ )AF! Ly'dSv ChÖ\AOuO,3k )5DOCtnwsM'enQgLs>؀|:FkTS vZřr' O7%mnD{mVy xSd]I ./J3}* eΫ.KUN ߁0nSӂUAf\]O áܔ}]'k;-b2t|remq?"e3`C\) .u1q'ML6j ؼŲ HO~qG햄mt|A8;zޙo%{(?2<-"ϟx>V`͈ợ -xh5D⺯}]R*lO>]_Coބ].I] z28za;P|űÜ=s'5|ʕ9۔clr]$oŧCb֩ޒS)M:rVwo+40V`U,4KFʮQp _aV2) >xQzf8ʍvŬ$F TSεe j$YgrguuUdZNY<]}9s?w o#(o8Zj`.+` 'm9՟Ah-#5>xY޳9NиǮB% f&{9E>Nn;L9 MxF?*;W&xϒʕjhE^"5(^G!*!xCy3&ͷ,xFS:)2xeOybirWt>WCb[˪UŻD^k m_O2%8n" jD*,&ueſVDT xPuɷsw+}AyKw<@^sC(_MLo(]!@ tleR7 -(]iCvˉ}jyY&(Vg{ ^hwgZi>.遤UWчCw驇BԇW3J"8+nHDH?҈^;b87:MH6o/Ҹ _U)) Xg`&*wf/B{?N!h7/ހLK+PnёB%a}rs !+X*X.tfeȎ1:r. jEF*B9"@y_uԙq'Ay=mjM`Glz;HO/R=>Svx/EMM_y:rXj7Z9XU[ ~Aؼ6s(WS&m%< ˣ<ٹ(tf [sr~C9,xKLXeGb(OXD.M-l;oӷz`ڪx m7p}w0R:Z ELЍɠH:Ie}MV鍀DN|YJ ,8l&p+o{ 1cK&@A4?ا)XxB0ij~%ӤC4YLcI9#=w?Mw0$ vD1@OQk0*ƄR"oT9b0Gx2NU-M~?z0W!#c4=!gkHS0|+=8_|1b؁sҘQup>]+3<44o#=R aj]:eiF-p^ ޶댏0ΘitL//тg/嬺pzUt⼷H`1Yjn9Y˧}˔yBQ=]:Aʴݛ3Ճ6tTY* 9r%4D ՑGVC RmҪ ĔTmE3pC*Q.VEi8+KMR( ])j#s]g. a)`鈼 u~ 5svtw"VQ܀K pskd#8z杷5?hkz P%åBMT4!Ȍz"j/-]ybΟ i,mOKrpl5 oȇLeP" VHm +V?\MjA1 G&md6qfL!c|7\kB K.)qOtD]3]\5<e@d3S.y-a\Kf>y[>F臚?|]`r}/sc?^"P7TrUƲ^,kBDg&Uu-@h m`%VgEh߮9 8Y0K-]oH6o}nqjDڸQ@<@l(U+2wɃ!M ɔ&TZ6L۵*C1\?WXႾiR4Knjp^Ѽ #p3H]}m]hZM'[6L,we/:3{z-?:rR x%Vi(cw$67CE]NLwM8pyZb|D=[Rh:$wJ+5")i+a'OS^ w6?n.L:B!z> VzV#_ytb|jц]A,-Gk "bDHb]m91ğ ^T"[gLB/Z{ea|=L@'dC]r.JGr\;͍DNgɅ0\rjnn#cZBZs<U/x)4?/9w b7gQ7o5Z.JP1/6 I)k7`}, m OXgtTgg*7~Cn}gn OoH% GJ@=/̕zOmAi5]`9Rye;dGnyq߿,CO!5RVْ?UK c$=2T*ِMO2}+-X\ͰAcĔ%v&W/'by4zS*øUe%nAhfdr Q-u[nZ? Ln[}laJos1Iӏβ tO,CUbsi ab[S,+_Jw:Z1|`,en݀H,8~Pů dD+2rҼ֊<h @t.a7m1/f4o1ͯYMoZ A{ܸY7h^uP"yS-oYoZ0,)"1y-(7/͜[a;։nC0K+K ĕzB]g y$mH<2nhzMoBncV5h<^ %_X5y0*azl =j>-@l}bcBl77 T vTZ2VNcپ^ g:c%Q!lIUD%%Y<&cM3iiYͿi`dk6KЪu`ҳ|!0j7S#-[?D.!ԷUA0p H :g~X A೸y<".4ѷiRN&]DoR Uaқސܬb[T4;cr{#㕛ۗ}O^z(tX}X:*YuMjDdzHZD~ixusw61gI?Vw ܨ-PH*h4y tP |=V?Xkb&0QS3+OWa.m1BKq{|}!څmo ML_ፊOJIY CF %J{J<򲩹-{c{_D¦_Iu]U5R %.}3~ fai:a9h(&Gx=@, 3mPiTLĨk [./~oݭ1z* Ϊfd<Ծ"k/ERsѠegBqzZJdRlK`}x:(A"rbyY1OI>z-K1RUaV5xp{8'pI6c_~CNz_)f A|FP6p6 %De\KYR: CK0~Mwpw$W4#%8ڮo҆ e`&(8)gZOR¾Efz|Aq@/gѾSǽ6 E97ty'JaPLNspV)8h*[pťOlHsQSͷWZ".^!ӏXAԨ1cP *ʌϠDJ!Rqzz5-@J9{kְwpN<6^% oy.cbl>yy iA"*z#*3!@֪;Hk -`*QB~*\ Vމ/>rx Yw㼋6zP`)DHA8G.HНțd~e G6n}3qLW̐,Hud^>|sS {R!3 ߬п{KZԞsKtvC%ƉB&t7& #mnS ۓ-\=BF\ JVy&DkULsDp~U"wXS׺;!q=LMsqw OAfi^zuWLn@EqEʬam [2~{oN y; ;0p@Zpf@6Kqa%ejaQi2ӎ\)IΜ ,MT1 Fӹ2ћK;&ڱe{LhCE?F>igܱI#PHfVQ,"tDq5"CB^jp`7cd;[5?)_^"}US s Ut߂Ɍ\#wglAYAKUmVؤw(vEAGEhJHeVKU.md2bLx<~\~i*ɛxtƘy$sW6Ԇ%.3֜jۘDuNVO[[Q7e"& 1K譓y ɯj_ۃIpXE[gURBϷ$o$ VRM<˔yM?Ms]Uq,GĶދD{^wlmB}e~FTl'dYdBDBItbx_ήԆr!O=N-$+p+Zg`bKk-{ifh$j[kߑ?aDč%O@̥l`y^bdk.7bd>wp iJz&6fZ$EprD0%ejwps#(ok8_%I^>EW/ۆ6^BX=Qrϲ ^iq&@5V̭M#7"]hO T[?7zgGOrÞ[jEQ٬'Xx:T/)Cߖ#!1"Taen4A;@ß]y۴|ؼ6$gF̳u,B^EvCa@|\qNݡ=B]6cQdߡm6V=z_P$z?h7Sv3>qg񌨫3I7A/elvQh['\5o`B@ 5UZ2rro؜]0:a@/LyǾ^<˅yk$I/Pv3 רjO^`[{16`h-*mᙖ)}5%sk܀" pXCw42 kn("㐠2 vL07$fMXn.fl?Ck/JSsCȲ&MV6Mmr7d̀|̋:LLXd !D l蓢A?<n/8pep6uȁԶ긆ʧhrQJNSw*VvD"%ji2ZCVbCMR %"S )bh8 wT$g Cg#OyL]RћGYERhC%fJ6m`”H> XdmpuRS$ldbiqM߷M5h3U@h񳣲\ۏL[y+_@ !طEn>Lk{|uZY2'ӓo@HwJ-Ks^4.>4zò*]j(̛ Tèf:EVPTt ,Xk§<_~iQ)>ȏר]ʼn~Ur3c ~|?{(; f֠ % $ag%gn m+n(.&c5~H,qr[;iI ^(#/+&l}RhA߮cdH J S/7JKYMF{az|J1(S%3 Zcc q%b|^5".8X1/so:MW++PXI C(#485LeEqb:p>$ƹCʒ`20 ;g*>Qy.M壜lt5tDw1/Z}y]t9)/!5[ p/r$2Q7dtI<`4k33 ڀCdQ$xLL&xEZ}_ü5DhQa-}f+fSoj Y+,%K34 S4nF)ba*dǾ̏轓%7ڝg*J@b`_Si˰(,~ :Q'g (qV*͂mTxz=c|9ݜi+5)|ϜK薥ˤ^coyfu9ƫ2Pm(zNƉE,$ps۶o]N U%k*DMt'"RB*Wړ#){^w ON5kτ'VB~.Y/#\(F;$ ;kԀ`]3̰֨ /ֽ*B?wr+o'%)el{R,_tQ xaj8DFCzpߜq9 )lI,#ӟ8.׻P'Y)ICt1YkZZCتءmUWq{fb4"}B6Зlۂ^S?Hd~bF^L={"݂:-闋/`߄ Jﭘx c~6ܘ@qOG&Y+7yɏpeb&{V"4Љ>s)&%VJ(.m~W -yiJG+/cn+&ˆ:qegu; g)!j~rx>  yZb,WI f`Qfk`;3η*y٧: %%QƤN@5D Oxr!_9g-XLH4T]_X2< \kZ+bg]&vV}7GUuSDk9ۤ>_Cgថy?/7/m1W^:9#P崑 53N+x^y-zfɏs&Bją{鴌]stH)V`uؾ'V]p=E{b8>*5[&%$gԣ[Acbm({9b޼Zdި^.U513*t|Ձɷ r: 'OAu m(þwv3j Ff+Ͳ?@q2,7w=TɼXl~}/:`c]jo|)b?>kax9c'!q:WEtT1[5ԻF?*0BܢBǞ Ƙm3tE1};J3\USCen .K2Y|sެÀQo ,D;zvw>[q^lHk@BU-ٞ :s!XCcZĒ5nիV[7!~a%>xʿԭSc< 6bWK] |L0PvSC4Xڂ FT/|Z(gt?9Z6;ijd>X.B dO\Y!|]ț_KZtz%Q [??i(7,LpyhVmƙ@dHoK6:AX{g2V\ tvwOi z PZ0BS4XnH"1> ]9iK2|7NB8=4}Qc43' liR{8B$L}T#d TBqH{MidD(^&j/zq-pF?]Ak;!m25 =7X";{+HX[<ӽmD{/1ha)kP:ǀPY^S~%kŪщ?t덕ov5#Zw67i>2]3jqD}JT^fSP$sZ1$8Oa 眝Ncq؍̋iwl?L񤥑rKhe[x PIn4UL:!E;1N;0VHdؕX{d=BJ!*ڿZzh_{!9rx JBC\.F2Yj" L\ '>юnŘk Ho)2Üط@,-Ûb<]prCscu WrJxg:P6ƾ$=kx5:p_õLa[;wsa ̬_>/Ře3һ⣠k p=sQϑ&ȸw)!Fn\dP*& X~ b/R*!ٖwk|+mIXc̽?ڞݎ6bSKbUlh?RbJ?vcwf漸3:\-ǂu.q -k"iF#<g|Equ/M^g<72&(0  ^DK%Mմ3r9?>t =ܓc9ϕS}ii+W:¡e]n 6Ru:*&|9@k ן:GU1zkb泝iOٚLxٛdɍE"Z獙S&`.Y޴@_;Ct޾bozQ; c 1[M麯6ua|2ٕ+JT;.ANm;~( c`=/њu1v7m:m7ո+(UU>`nW\6QX Mhe: ꌕ&rwʺPnI$q:C7B+} Rx@#gZHNBsIFnFDW}{&[ex }=#]a< Y˷FխULhV-l}$I!هȱaykb7 \+`i!n'WIuTH/ٛX~iP鯁-"QK5ݔ3~fq|vʤkYR]l_GpySaċcUP!}@2ԭ1Zcm*Z#$#ՆG(e!ډ侀D{omqlc (%%Ggl5zEHڭE;sdٞ7 ߖDK ?~hJLG2"<N1fmfa0< Abai:Tмl/\N˻EGmz S|Wf\7Ӄ~;0 $`P:49g/B# {f~.};-h<,߾ f1Wy z͡o2)lRltv[r6jsfRQxOT z['z e]Ӿ둾T⭁ocSb T6~u_s~ojOz뚋2#l/|8Ӑjh>gc;Jd$'%Q4 (tB(` :%{wbOUYzȿ>5AN|}xZn͎ [ h`dB|CxۖIcF+l0_62=nA6Ex6x'4g,E"Q6듫,cD<83)&!bzHtV[E\W v6ho/C}G9\Yv764\1jgrUa]N^Ae5hɚ^ҶFLC쓠]/2a#AV1ϔ$,ѝ ]R>Ut}שRV~H;/ .[9dbegn/'td.˨j'%~z 'Փs2Y-jzeX u *<⒆i[9ɪA)@߂fcteL[W9ō; '2FԶm5#߻snKG$c >kYa}*5 w]w=C/Ѻw1#ǟˇ7,iWTtg{v!2eX4LjN."D9s43}H~b/VMG_ \\ɒk ޟSb(eƜNm:zRU`ׂ~!B/^S]0c$;JG1qŞrQH '(+%=UpCaSzj"'2ҕ׿TRffUig R1iѣnHn:5I)"CC$;ctdo΂KxHR˜slhkH#!>FM, >4S)G(w /^\d3Puf%s}{U'q)`IwۦIeR0Oܗ*ARlyc[neid|b 廂ѓ[ΓS4ES#E0hġzhݰfYN|5fgJx \&Ey%Ih~ *ZTsQR<#ldByqhM?R>Рh}#2 Lqm C2.~zhfU ςUalԻk!&!GY2;Zҍq03GVH:gF!=K$DspMM﫟J0$dkn}(Q3Z5rUSƃ#&9;6@rp8$CWQPv+4A"FwP'\N&mAAꭍwᝢgHx,! 0%l^á]Ȇ#6C\e/o^}`$HsE ?]_2+npĦvY#I]a#s<3\xk86YZnnI̭|"i>;fRH36 Zl<|g[&ydO?gN+s&t,ݴkzE\~u'4!Bkp Zwy2T"ߗp\M6R;D݆7c)1qrϿ]^ZI%rq:^{EEۚ\,ս]}yLTi|w!|^['% N';%(bWW,ɽl e kv˸LFV8I!?*sP1/:@rش걀j [?[am/4[:1C]͡U9v 1ZjnݚsIs'vw'f6KNG0bTգYtօ R7B`!;lT]Agm8d`gDH#6"p5)F E}|E1[)WݼBߜ"ؙZ4Z!ސc !bp" ~֟d7,,` P!~!mk`6SZ])֛^%AoӕYyE3s4Q"s5-& OJP-!(֕[[,XG(|ZݼpIll5Ηhf2;4%u)7sUiBv5YԽnW"WYGI`x7=n;rvذCtGI.aטw$6`9/H>7q`G{-\IfōvʧC8(> Թ9H%t>Nn*vaѽd6&;TkiT= lup"G/tܺ->f#Yvl1-,>>pGЄQ jxb@am$ Bš(`TqK9-#y Soףr}}\#7*XUB D|f:cĈi.Ƶ~5wB3&Ϣ KԽ͋,Eq>"[;XaVuCj/(ֻ .} %FT6܅OrD> lQN-K$Eex֑~6T4$.U"DtnзOZCq_I5B tr,SaqU؜9}^{I Ӆ[i2dMx?߸XW~萇z&}%ӏ^H6NmLy=W ;+ mzUEexȽ]]& :"( ;`:J 0saLbWb?)/}lkwz [L6,=iYuOJ'JޣӸE4.#c>C_L#)KFt{eAvEJcuR`D(!ZZΪg[SZAD7坃f2֞+bow`2Qnڨ8rj $d}ptb量~}4o#.3)N[Hpq >'"[o5R$HZyTº\Mǰikf-p@T+ O~ov7fVgXn%]h{^'ЈLwے7?FqHDp$%jLk>DX4r^ݡnYeF|z[]x(jr- GO- Ҿ"Ǥ,y鏷uoP=Ux$USPApC E-Չ. z}R8|=oeyg_ށn~şU@\'3s<^du+5qOw,-V/hO ߜ,舭Ks8̵>5%Lq":kkuSQu<]fVMĈgHg!T_< $dCd/,\ߜ#**`_J2>S{R"!7HI3p;WeT|FUNjU)͌1+pj gud肝өLբ?cV[5+eH%xuu_r\Xe#AWuϔzȄ1js_5@%qLmcͺLLhǫ}s]Aތc܄7~@%:(QI85X2ܡNO1z(o:: l-al>)9ўu4ez(apŸ$^5g/Su6*byKxFd,`Sb{ݡʏ˦6͞&'QɼEAUV)}{J /(v;r5x}u ;kU[+#d# ax%ʜ<.59éFS>6FQR3/r/7NPPSk`І&\鷽-"YYϠza%gE@25iv[$|Te5kћksH eڃߙ;_-`IMR''?DN.eHP=ٙhNhVt=` /XkAwIq44c3!cfM3gGHc=~r6 eA -@GNX ;OJ7mx.vItYrJZ . #rE6x-?,RF M3XuxI%4JI8c(Mq~LxRmi}G WkyZgCQ(j1*t2!%7Gr.6#d\>礫-ex:`珀$wiu# yS8]37CI34u]v!i+I';̱nt{y瑉3"H5$LQDIm.ԑ =Ɨsh+F>eK9Y@lMO=6<bYzroEmf\L_OZ[rV OdB.l]jsmgW9{rzS6MGnkx0%{rX)RK/JAv%|})y/JuI&c7ɜԒz*+1Iv_ uzsi3kQqA?K/>veɕl@4웵2c/zjPB(G"<-{lr('2 !K<&OwD EpqyVZ8)/22+(5qm,4]brrgY;pK@ Ǎ㺫Ib%)j.0'Uͺ1[q}vIJmrSe8|\n RF/G2,y%eFw5Uc$vw^ӉhI Dұ(ѬM'Dk,abUqg_@E?ٖ XSFoJa'X97Xe aӱ {Gyi)HrI^kO@yHƦAV\`qD&CcdY٦î(5s8vo |{,PG .6Q K 14FE1Œ `2>tjO 2U~맓T=2?*L]nUũ0Ns^ qTB Him?~\[2 ]AZQ`IH݌o?5q09>ꇪb]}hƵ3G^.?W0(f.U M6rCc}R$ 0ʲx2ƙ:P&'AhntQ}$3 Qqkϐ[p%hNܱd鼼=vjزs[_zNq\@=|OwUgHS*2g/"&pȀb#F&>kqЕ6Ho{1 jٹwW;`&ن'F#M#v{Wv'.%[%_fU,}PJ&OjY;eG:Yhx\'\s!D_ 0KƛP t1$AHM$iL9斡}pH碿zDvSlV+i.,,akw^hoX9Ok,$zt|\K%QD@? aɴN)QVtS<`Ʊb=jZ>u"$ݔ }PK^D=DuYcDBZM.~ )<򆅫!Ԣy],;XJu o%D;HPӪ0 ק4+{j}}Cѝ:$ =r;:Ik|%.K?pW. {NBuۺq Łi=LoK>$8:uE( lSu"ѼKG\YOkh"Z9>H7n9pа) 3+Ju*3{Awi->0?FPc$+)j6kTD37irޑױRsBU{` 2v%MbRr8-].wR(]eűxkfzH0HB ]J<ՋI 4_ZoԖ<͵a|eGVPls[scwP c7Ⰶ璜T! $H3-[b3,Q#˯bن W#`.mCAܡadcrO;>F= D\oE@OʏU%4D!?!IrʏXQf,U$)u|N'g|6H]~C3]o[Y_6a,;n? lݥ`)!Q=T ƣ$> Z~*ۣJvKr>0Gj+'W$j< 3f1_ț)hIVxE/s|>{ף뉽0jTQKjP_VƲqR(Ncvz[ ۓS\0Eݯ] 3?W-vq.uMf-? pE>44vNJ㼭{ڗE] nT:a.ol G.#ȷsLgz0AhvHDe4!OCa[3𨐪}s_۩%Pp7sݞ: Υ=}+˨qoQ[kFlWOoRD gT\&g `׈y$Q,c!lk0-;xXie*ΫP3д/e O/"{]!4uaZiFE!L0!UXΚYe5uE+"W|Y^p;\n_TFR&2Z'pSmV( Q6O`%!ۧELڧpYO۟k] eM܃cz}5il Cno&mmz>(uI J^ pP:u7mHMƦC94CHW 4e|5tc=q6TՏi5EDsm͛W.lACj| :D=T.)[~w%+#Z ෰׋%|LGkD/d TxqqCW0Жhyp'O6yV_Px Y}Ұs] aCPwȭbhXz"6W렲k{<3dWji֧`j&ti-O Tb1Qh@9C K%A*L8-X[jP/Z/ҪU/CuCÁfafϗ%^% v䠧g[H]tTp`ݗ&A]JNڙ"Q89w=pv2 $ݝqOAH2XkD=O{(sj^3+s "'[-(AZ([U [ԅ 8:6^ӫr k~G t!)jC] Rw C>Z&ߣ[w澙~ӥe=(wx@P4fy- xK/xJ}[υssMdc6GR_ DZRۨ>~ؾ_rhCw^M)t峞F77FT2ƾ h_P7!Ba}j_~=վ*4xdӌ,jثkYűʭwBvJ0 ;o68s ތWR{oΏ}7e5󥇁&+ BfrbyCf"߹YYD!0}Wԅ ͸6"odr^zG;.e|_B'N0^>KXs/$Tv)Iր(77+$l񕎷m|ɝz6oMT|E=X.*skʻlц7M ΃4;[ǟ،䖻͡nb$pI1=h01&P569_bo0kIV3,/]Bpmzn zD C–xT9S'1$TMwf|3D7)v ?5 6VɫlY90qtt A@&>&;zR+*{ckSr.EXwBlL WQ}ufpisEvkxyS>η<ѼDNv[%IO? 7~y <6VBsH?H5D6fmgcVֳMlDc=aiLZ 5 ܜSO!gnTr syպmFrJգ(@'8ϬӋ[uڒnِ%辄fh&ɢƅsT(ĭƬ(jN\MAa 1'I PRe#jI9e)i˗#f4΅JBd@Ȼ1VF˱;kѝQiZ#^Њ`z>Fes~&4(Ɛ-)WA1D 1ēbh/7Q8GKx$EَuM+bT3@^FλZNiwׂНB(HZ?y>Bw{b*=zy:Rob(uݢ/f~xT#yNXLWg8RB. ?eAON7!\8U2+#2 M)ƏTx҈w{"S94Ecwsw u[ax՞p ;@ѷ4%y0P(N0ipƌ(β@M=p/Q6i*! `"gR5w ǷRee,rAq]yP8҄e&SX\94dgoR-ZQq[|7n vpu_*s'YGݰz\YuHk u%H`B#M }r0a*9ɏ``R~&9Xֱ4MB֫4s "5^OJ02['T쎃⤽<ەAA K@i @f,솮/֋PqȈkD~-:ā 룫PxWl`(l+|Jh,Q8D|vye&/Psc4rbovPҧ&wL"L 9I~GбH`u~GaxJ1}Vw1ijD^OvX0 be`]VV:Uh9ULQU I:6Tb,5#n[4Y 8.(UY!!1̴ĞѴ8aUjь@./qsC?eœ+YeQ[d*N8N5Gdl lg &&Zvy>מӝFL=~@Î0fy8a-s Bl_e,< W@b2V~/xaRA5OҿQu~Pe!&F'Q#V'&4xf(`h"2NoߝR Gw tq9V('ҟ:JĖyWT'O!|" ֖:.3/jWg9?k_T{bBݾ tRH|INwK |q%#so]F: .oЖ`F,p K&D-*EjXO;{`'p2i̒i[xڝtvrѤY*Hm-$m{*tomcNsm6nU^F]@IlO"Pb4,oKZ&o2F|'I6r>k]␦"e|!!HYUόǐjVy>b;[@-^X{m&Xm3gpB,;4 NCfkq![" zqm.6%Q;7·A c@, `!n&_&y>ﳘosqV)pN u!"4Je?Txli]^HmRK"?C^;|A?z"'Yȣw^,{B^M_VLJׯ,^D$w/ѕgrG^DQp{4Q, +.GeS4x Bw z.\h "asi [Uz cTgS:ޚHй67쏉G$)" W.Z>!W[ Qd- ժ^7onpэcrN ī?~Z‚6?_F΢jPq,=)]p*M pQtuGmٳ@' *r!`T!I 3{}⿆O R8584x.>30tkU)]Hi!Sh=qԌUGeb.x|k#m"?"\gg"Yv^YȊ2Y=LxeT@NԷs϶EejhG\#nO6p:*YvT40,͚vhAYӧ,j!2 }wJy$@ UxQ*뼓)_:Aߤְ$Vc'dDyWqLQjd;tqj+zر~-q琭oxI mp@5_z%=T)|ߚp ~]~j)㋓reM#F=7i4p0Z^!ÿf:d`P*"y&, !8߆5'>8x*5x{_7Z߮utVWS߇*Aiد'la('u :t( /,r.DD^)n,獛݀>9oX-=%9-"y¿+l+ u6M'T+ĿyXw،Rڧ|㲶74zx Ղvd 1ڀão҈C@ˊM!XhpUH4.B(KPb%B6.egS :cЄtfa (.asY~˄LO`ӦkjHHw={/Ӹd5! NI/~Dd^lFL}KM|KIqʕ*#zRO+@S6^]BIL;~棼>fK/3{MrHdw<=jrJ$`kGї_?*>JS-2SGEx;#KNḡB"W0~pgy#-^EQ@ǹ[ª b.S})G4 yeo"H;Լ9r'`OtjU"?B7veAib@|v xCukh[bۘ ?"qz]Zy5z5m4B7Ɛ@u 3h7F| ;0g!׿,l>-z{C!N8#O2m+;pWWPYn?nl ,$&aIks,FGзЕuFU~.ŗx/ {`+)Wl1꫄AAW.L%2 ;)3~,ບ‏Ϭ|* iq'`hFYi"[ aȥ?7h -ULmj!X2Nߚ9 s% 'M2/_MXlzqnťɭg"qD8Sa_QKJ#F}-Jvqzx !k n`98h bpDk$*lS6iw71<0V7~/xI5h@9x2Y^U+VQNXW˓Al䓻2sGtIJ$_顛jxJ,6Wp!J(ˠ<̲ϣ۶2UT7b+9дlHqEȗXЬHꁆHWU^Չ@wBo- uԧpKD^_V ժU&Lu9d+3E;o)X:S:o7=!_aLQLCՠG*sYy"Fˤ\8Mtn oAd!-mN)/u_L и}tlpl!};TC񢟄GؘmQcN[Zgñbàsi;ГR74[V-@ĉ)L.XdW=PZsT zrbԤЌL>92R C3[ еA"HJlaL w=:U_]ϵ? a8`=zܙ%ͻ5 [4wMW!Z D_%1!pKQg=k([\VX Zݶ޴eKT;0[5 :ѱlr {^řI׋zL]Fo\far5 a&{irdXӖkl")} qPsg ydv\AGp|֦;?]2SrG3qbPoьbI}+z=I4rYSbka k_uBCZT<9࢞NrZ? Z65LwRn"/rPfAWk*nWeKLru(>zLw]3E1΀" &  I5G:4t‰]lMve ̀$o9=g͙A*stL)u!Tf/BGt?_@8VX؛r/j|ԁؙw6)~\( KÕR KC 43Q(sh"2 v^d |QSQЉ 58//ÞTfib"zME#r&|!OlM:_, >s'SWSsʽR>jciIJ*9eHs~ - `/1TVM68b0+y_uV{@[F98[ih`Hg)a2\x6܂<]eCj 3τ)k/N*aJzCIVW-odYӼZ&lSёpr ߘvslZkXʰ,ٞR FL{;5wmqҗ#ZGۿU ]^J3Ji8 M]>iĕ1"K@zyXv,{V',X^}C6 P^Mh:K&dI*Қ~Ƭx! Y\(XVO9|u?ޡ܂_RV+YW8c3ĸ& ⌄P'%\&Bh5I),bOD"9O3r6@YzXV|}bj3"HKmi;炨7੯R'(I±S0D m;{^%W U8ؖP7+?z`o"߷!t2O1IZҍ qS9(bf:-/=!xց:cy+G>=)'.*~ݒX '~{iL9a[tPfA3]owL/萂 uo_Ǜ0cJ-S,KmohE}e W@\԰fu1´¡)r[C8qq[IxVl;r tBm~Us5@فr c 6p2?C;+u%ۢb x?NLa ЀLZ gZMҏknvp%eOEk@hagl6Bq$P>G`׺NB# :]cLN_%n(먪㘇;9śC_` u]js;NO\WS=xt MJ;`'vv3Rf1?_ScEֺ,<3a^n}Tdy]ŞR-Ϩ#\@$Ҽ ?5G37;5_ GmT"jb^귯bCR<4.!,K2T W}- W6*"hwª0+C>:sFKуT.ݞyte`)km7jc'J;ySoϫ7dqs!;)s!I$/rie>╣"?1QIը:aҟz 3ݱ+T[ɭ9nfР[+dwSzU"V^TQ!嫴#)7yU 2H(P\qqVS,S|cAm,Q0oL90a?z:!պREܮ,cOeUG58<|9g@lBI&ʩzAJ1u>3'ޯ9Z۔lՐ[NHZUA?Di=:F`֩5 24b3J E ,,_}/['нp_`U|tg nla@p+-+Z:L\0ޔ ĝKjYL7N}m.,\f>Z.GQ`P*m OX<ԑ=ͧǟЃNVrmFY/^ n ?M/a$~J٬75NNI/?nHrJE6Zxx1}(# :1g.,3E5ZX4y?ݎrQu$2qJv.lq6TˆNw(`"HCSd*o) R;u٘/i?=x֎A/EuQ?7dG׹i&ZW475Nb"8Ja'p:6r Ԕ3߯N>fLe$ρzLH>%+h ~M6 ҌcXFBK\MVgD* x!O%yJ /4F@AUS"^ùܛP0x1@RIWŎOxpl(OV:P ^a1jXhRRwA 3J2o8+: F"yd7W6ęGdgM\GaB+Ta%3jqD c矙q,]֛__6a4$Q&bxx^*I[K]>a:*2 %0KF "VZV3t3#;F= tN@ Vu RGJ^wY*T˫2JtQ̜[ߑPrQX"D_7R_Fo3WCBYe^lvcA)x`#b?x hm5ē3p}С%. QI CHL?DT}X|ì_q) /:B1nu Ec2?"0Df~mlmʨ\ȻA ݲIw݊*F=#C)g 8Z2}VRYvD[5䵓 KF ^2m@|ƫM!;^ߴT.V[p6[ D<? 7 `m8f5Mxtb[l %;曗H5Et'9 Ng5r0gl [ e!W}^A:'0^UnH\IA|X2ڮR =W(Wkp5[|RIhkNa3O&8b,Džlj.U迨cUM|uz:SecٷۡEVc `ܗ}h8}m>VH܅̃cU ob} x= x1LW?tZoKfpƗf1ψ7-m&gx8,R@_Pg Jꏇ`B|'8\. HVE زC~kq.||.ǘ!ch_gyabLuH5J+ԸLt'YyKg| 1bRazI'?HuyU|>7sb{P٢X2W#Ҳ#1V7݊H#$EHncʗ!̥l><0(StL r~Q"~iβLMݓs䕂*_Њ!)hBHKDttmb~d3R]gvC.GLAJE7#9`c| 3\FeUz V,PipoiH ~45 I3n7"':(:ܿ19ufj/Hsq'W)gA`"rޅƘP8.|2b_X%VQꖙ~CP:jthx~LvL"'~ʰLs]K15 eqe&#5 !6^Dy0_yK4`.!ZH]0Q&՗֧|SHMw{-mz=Zl7Y:j1zWKsCMVeZlGSKR (=QNXJ^B(%lK/鑊~> ^r$58 .pv$|gcCy,S7\[Ȱ1X76ZKQӒf lzGo֙;=;é*$Vp xUMGeX&F@j vL35ρ-EJgD'nƣtx ݌T ^3/G䌙dz 063:JY ~q e@5II%~E>̓X. y\~y r?8 |8צ9")΁"nkYZt~VzDqKKҫ\lL8V^u$_=x,roIJ$Dfeye%X_-]';'2d4Ivoӫ)$"(&1-lklN]#P3hVCNX@؂ J9++{ֲ64Mrx|`Ö*KloD]xB a:Yt?3;Z2"g60u RX fpG+wi9Z v4`eD7 2*S0t?SR=@RO^flz^*,} `wc$S=9zCҍ !/6y1rZWΑ֗37G1IܺFȼ?KĒUj9i{$14%kFjAIx5PՏR2B CMI 8X ZąK:~ۮYB m6"?;z- =nkghjju;|P6s*/mNDG̱2Zg-$ @0P VnA`Vɫ;!ػG*Çe7eCQ?_0f"f{­IHMA .|fpjXHܰ%h.h, 3k2S42ӽiЗI/qI= ZܽF"=}FwrC63ȯ(~=b؎'~Z4UTMSw?5)g# Bu#ػ^yXdF_ڕLu]ύK#m4?H"&<0o;[P& G^ :ueyrKLtf ^)1I-Cj- =,‚znfJz,[@9PjQ"53_ih +9^>]I9KZ}WkRE_OHE7爫n/=ŎBF}̊*–4qQ?Z,§2K /?_m 0}/KJdZ-R٧ i7MV)zE0ç-z+]"vXZ{pU95fs씯b.i7LǢH懎V{{_&#|Ny34C# [={n8fje);n+=81p<+3Psl󁑑̭0N?- Fp"mlTp 2_Y\vQD|zU oroMҵy-?&Ƶ `6^7 Nt٭baj\)8fr~5T>wj91!m ubm~x!n֗gvOWexl۝!R|iueS{KeW O1V2 R[h_C(J|*<6\Q0dɫ<۽ty(Iq.WS܋'+u+cSѢ7)&$3M{q3B =ZsUQPF/b26 !Iogezs.3P ^|o0j-~I3_|n9>]mv'%;1nb5-/ye@N~fuR:S ~,HT<xD}l7+oH`o;tJۧ{NӁ\(* kuHg a1pjzZѩԕ aWVOƏlS9gwbP[>Ug*}l-k6q}LcZZQTkbTs^ s3ZFbMДysNs{n|!|NCxЛxRcs*Ո#ܜoڋCde H".g@EQ&0?I7b4Uak8/wNՁA|l<ڵ'tɅѧ8RZr3_EO|`k7}'E4FII݊[EcnF9B-:-=o,HY+dTJ?ǽ2WI!2Y?q|9 @ BuNYӈmq^G̢MmYC ]@ IDiph2 7֡(yҧfԨpQ@&kYd%k_qBV}7B߳ryYN|p+ʲ?Ry]iaCe@!7 C|ybݽaVVH`7G"Sa&ƻ I(gL&E^=DI&!(-DE-#|"6A9, ؀ftE;٠8V'h=GWo ^ )l{12V{,(bP ҩ/ge LlFK79tDZ ׾uѵ(|p{BO9AS cF {rSZpgC}8$Q\oot66xsȱʤ ۔ZPn1sF%#x2qN*?L;g_)2v]闷ɂ<0c7!Âs'g_Q8+j1wWD`X@#'{TjSU)1rUz\]Eֻ 6|N)sRu<*iȅyS!"vs'2@DǠ;߳-|~0Xt@c9?Ś2HMwHt Вu]NqKUɩ SrF9ix,ßfg &OY/ OGyxfܿfmi R&9_쿫y4S)twWFMXE  |T㑂_T:F ۓ>ܒx]KRXZ_YwQ$NiA!эmIj2oڽ>15abjV&N=SDꄥ3{Q3M(vbTf@BxWuQ( ~e?ct ~`lŋvXjYםU"1:P R~s] L&~p[ 6 >7TFQs^!X>Gfc. _.خߧ]u.:i*!xotQ_10SE ] o5@T*_`KX 0UIEm>ot f*-$)~E)Z{ѺI|s'ݜ)(db.Z""M&y5Ll9'Kn E _.sdZ3\Q`pW}W>)pC DPb nx҅# hMrɚvG\ ~߿;@rHf".|Of@ 5}>d|󜅄d1 SԆ ܈nr.P?f2[%\G9]DA7#43QyNGh\8VqG^SD&][`6Cߞ"'*?L2Ҵ?7AlOQ_39ɓΙڏ"Pp}A8,yLi_o8  JL6ޔ` P5):\E˯%$L.$/'`"8CrK½ 1?69fsh~C wN|ʃDԜ=el>j:ng#qk8x \A ~/rt69a1}-, 4)ׇKh j$3ɑ3<IKaMX >HdEpN_c|e8]AE_k`WEL3~*hLЄ7^R&9yVO̤&p"gGt]inM 7ݾo\b`VW=tM!`,S#lϨ4Dd|xcfۜhe|ZD&<ݘ|Әgc3Yckk:,DCzD $xn:A f^;+[x̠LLu1 d2hLp~ULZC>>ԉK|;j91{};0D0DAܴ F~<|~{2b"QeDLK2D^FR&{E{ʻR&m aCIcB2" ů݀e26 &R^uσwsqACTif ۘǔR,,]1&v 2zj-*([olF#{{ 3@djI 0 @RK ~?[w1St2oy!H{_יC~y&pao$9U;*s}UCLKDSρDZ١(CѩYdق @0C)⧥uw} p56K{tвsKfkk{W(\dҖ7yƢz0"q;,4L!FK.裌1wѾԱj 6 Y48ay'{{PQ&$j-F1TF,kFdE&6I$EJfk{fjCCQIQGoXiu$zW^/]7ֵl)?1yk{+I,֍;Zm.m;le4!!$7Ij{^^dzpYRYSAy#.On^r.(͂ V@f&>K|. ܗ.+8ł ͩA$1O&* Qzw @R#+%#E)IsʂIHZ,Ru^/NiחTkEmjj5FJ XBDQRl6}^ةBR42u*'#d@(u  XC",oJc;EBf4f4k;GER Mn/*)(AӬ5`@h2:H]bEMʛ_GЊu޻^IWKջTv: E^G>.UO;gh;U/;wz$$UX׏+12Lh#32dJI6iIҦȠME!&6eb'u&dGkRE^yo 6"BkAEDm$j6،j*Ki*(mL3`*mݙE/]xm2kηF`IAAj,Y(0ʒE ׮RI 3#S)J眻gmnc2QQId>[a0i @ԕ A1RڒY;SXؤт&YdHIELIi0LZLj)IcEFILH*7vC $QL1dk!6bɱCLLldZMLlTUwtkl f] (44QbM(RQ &1 &!$LiSiSSfi6(6 <łs\dM7^ݯIblQ4>Mҍ*Jf#Fi)-!BQI+@TdĖbQP12jHf$Ʊz>uDXL wMIm%X3TljQ5d*blZ j - jVK۶֠J"Ŕ',Ndb R <40뽺NH&hosFf4hJ5YF<+6iVue$Lё@B`w5(1l4nr" BJKz:Gi!l-mo5YKwvp$5UD;n.a*ʉ͓Ƿ+;n V/nɿjamAʰR^e r;`ondD'ћʞEi׾SNwџ~_sIfA@a(Y"_WQCvسʼnOkPgk/ɲ9W>cdS)@JR`,*hAJHޖ.&#ɽ[J I|VY :W/bQM?t%@z,(,Y cA).]&4 їigd;d:?IFdY^Ol\D&fN|d!sʸb(W&_Cn;M>>zj}?޴pIrerR$*o}|*5iW č~aQ}h;>Z0#8SXj\Qs[UgCR&$Hsr {l%IR a݅GҨA؍#TKxubZ}=ԍ[[Q?'{eO+FOl0}2skP38/:ixgZJ⫿盌¢NU'ŎR_ pa?>/TP8\ib^._^vf;9G`C#5 siɲ! ᯇ0@* ύөBZhnVP$kA Bd/q ,j- LZc+*7FM1aE "2 >48Ǔ Llc7  q_ QtU[ }weq"v\qdwLK(eTnx*w}NP C"̓@c:e U bV /詔IK~:?>yOX.he:mT (p08re7 9qJ;Dyҟ4vӝ,ZWyzrHxeʔ7Y"R?QE& 1Xn8/׃طNFgl\CbD~}`{.OÅ ۴E!̛3&\y G(O㩱\`?M?^ڐLX|W$2&)vEP8,FuR~{;þI|M|teZ<'RddG HI;G i8u!=RRT V 6ɓ幧>1k}C&@=SxDid^Tj 8>^a)\r)R$Ť]W:.>5r-J8H1<}7H`U~D/ET ^}×mup7R]{>{/?ˊwo*Ҿ7A~&#ˁ1PXFL #$h2STY4MKmSoddeE4SI4)nv\(Jhכ?S+ۻʮ߆I&dřSdBESE5h  .o˺J(\/iy Co.bۮS^nJa/+FIfuEd "m$E̒Rs֡[u״upt: lhN?oS*ړ[y뗔<Լ#: +AhS&\Xey޺<LJ^vo#k/i>2iҲ;TA#JL(B@Ja^(w0(YW /bε8p(uxL6RFm/uVZt_dTVF ^ !N ӑq*K9xwW], 97H,Mu:2#viH<|ɘʺ8{?QGNfSD4>O?v2Rn/Nn wͶ^NhfŅSxSǬ7ju{I;oW7)RNLu M_@|ߵiqȾf=;Ʃqapga}ۿ:|xuvRڿ HA3qwhR l-x?s=5=w56ݏYXC&[Ēz+JJ*><tU=smjݵ|M=S^C͕i5''&ܖ7a͌-D-*Hpl%0$GA4A"IΌdg8ecL+nJ{oE:ZRc`Ch*%%y$@ J. 9cj ?c0<;‚>We,M40>mq0P0~=c"xv6zTl'\)[d "@ ` K*Et_|vwn4ͨae\ u^wJZXQ1V=# Nbuy}O tY'iI!DS] C;w޾Rt=L<$`&>CJA6 TQzUD9fi%tl@Z-4A†t[C/(2!j&eW^Łn@%@тtM LpH.Y>eeŋ zsx%s`Ҕ%#ي^Hm=td֋n:JiU]5¤2Gr p&mpX\+{8ن}hǨ!t:yNSUUv$9\ ×8lV\eay{Ȟ5vZb{6)ح_[CDW G#/E֭oTwoݿ%~u|v#: ϛ VenbK ? R `0fd|NbnS'^20<n*j~U,jmTC"gc^|^ F<,WtA@4A1iL(HلHQ{eC0E%BXx#64^PLEso*BgN@ dT GϱƳĜeO| qMy)_sf9F@ǢEI5φ'z(\CsNmTsU'Cϟv'Θ7Sק7o](owt2M«)]a0R887}d΃Ay8O*l@_UZ9(b:iwǥsDdz/BrMmuU/en]&B+W97>m;fӸg];*o{cjzNkKtmVOj}>ԠjA~J<;IOnSCtѾ4Ԙ΋}g#uѴ-=\{m'/{sFC Wm3h=vOg E4. qN?Ƌw1k4:wp {]_냙\2lmnPW 3#u8*{ǾܽcE`!aU_y_( .~ev\98 X!w0$>B[}}k*7]e6Sπ/r7}[\eשMm3L$ d30I(:y oM`kڅy9}Nf񞵜|(l8Pc9;ZEFY$*}ICcVjVÈd3 aT03H /c9UVG! '64RO{^ч+x<]wZgS¢Gdǒ$Fg}rfHUqܲe_74Q) GIU%s1hߗ|㬢C~67xAaʵu!HMცחcshxѷrHLarM%yjSp\a^׹>ڛ\̛_AwM;,?Wf<Ύ[h҃{,V[ZÞLv+ߪo5ufrSE]Ogh/|NӮZ'{ 2ﶍ>k;>GÍOi;ȳ}Ζ|)eT~v\jaf3 RWbe@O'  4$!E~1{ޗ()^FײJכT%-PHqD,d]W )o%"Kd~s*>!锠ɢm'10d?#8k4sf'gJvDt1AP3T-۱Bw+5 y:p23&oqKD>[L/]_ڐ'0ȰP1D>H)S I.xJI6ZM0_m=;\UFDA,AɈGBP̢+BݤW.ght+G1::ц@A6qJ@I ݝsh؀JJ s&00Q5aڏo9LW6{:DunM|rIOPHj!w}3>*?CNRK޶;6L;E'R=>0JgYeH {j49 %^aQL b |3G7{sD=1b&p)G;4o|E`V~ll)$MPEfy G>EP\0%|@_Ƀ;.0 ZK*Tky BH v.FP eizX{xIgsZFHS! , Р DR 9q鼞SHH!U"X>5X2W7?gsx7ґN Օӳ~^@k9Z9}3Ԯ؉.:*m!b$8OsTbp9f$˺0-yrβ$zVx(2dfe]JQx;9Ee3E1U榬$1dDF%$3y ҉XIشi5=KܠrvnЮ{8j4̭xn o3 Q"b@!7 g&Tr >ɨI'vURov^ ' ٪J{:ydO#n_Xl۪IFBSg-!$ eoNj ظ "nI#H @ @P8n~4 tf;>YA0f` F RM NTЋPk|+1݁^lrT++X@_qO6)E3LKfkD_xU:Ť֖=CdGSjôD@iv!뤦bPKLf2MAHi A$~6tmȠ'ҤǭsimCe<:NQQ \L7yxT3!(L{GvK]J*^ffn@f 30 CsQL06ZILT_Z1Iב? g|yDHPC(7O\_z=@Fޢ->J~p&|˺CA%`eFQs뿋{8[uUBĺyhu^|]qD+h@\ƀW'V6J~waz 'R?^ږDZa"D!u?T7ݮ##Phx("PB}T C9k9ch`=~BYRa=1IX$zKZvi;="ӷ}fqL1a Zuets]gy?ip> ǣ, \&**29ē, $\!\2 5U{i=sycWx-Bd <#.xia nF@ Xclj_iPMήJr GvFLZwWͯ|!~ ?bmS{ЬԓFSf@KnFNYLIfoM OJI4 ДHD_n-RDDD>(t @BT*Rc ? 44z { ~_̘KR(P$ĥ-RD|?hӻ Ju/r![FF|NrzGsxuƈK%hn%QQAWp*$ ;;l;wG_{fգV( ,Rb4hŐFH&ȱVыlX2Ȥ&Q&:yMCH٨جmDf4dLLJ25]6*k1la DEiXJhBm"6;CCmÁ !3@E8cסW"* #?8^Do-dzBBT)=AΎEapRZH>nۭSkX| tqPaP1%JW[M_: ?\]+I(li񬥷eXгZ6n^~y\_~{z4)P3C0bv_q?JQ2{ʥ42}%#Eִȼѣlm}b1]$EJ6QՒU??PįK]K/٩^6J6_Cwl+L̩7$Ѽw8B:.K.94):6s+L{EmJ&kԨŎJ,Z/E-9*eMIlKJ Twt*&QQV3ÔJӋ͢nY1ENj)E"B$I8ss{ DtJ%X[V.*s2Y8y;ME4Cĝm4ؘӜV Si|O19KuI0ׅb:9ڰӣ~qITqk#Ѐ{s䧠i'wgp!B{$ьF `X1Ft&&|ŠEr'u\ۏ]﮼d~Y\5ClW#;,09 } Q>]R%>wˋ_:۽Rga˺sppigBF/Ւ-󓱓=NQ'Hv"w^o1FuM$cd8Q~s~G~=[S6){^ovȼV $8\ʊِ#@;ON5Br*L27jLxjov-S0~EF&+EPja7'l*:/VlrK<`#yDu.U>_ 0Œܹ)QVIJi3 3$g?彾=ʯ#Oө'uY̹Xv'ym˘ؗ쵝 I9ܺɽ:&G\}\)S#ݧuK]QeDG*l MBIļ$`#p\fuH]g<b!.Xd?B %[?JW[DZٙٗ'[v~?lwWˇ+ 6z~^a&7i\ $>>ÍyVc+ 8ـ;<* x45d[cζѶza;Nd%=9?Of{>5ϤV8rV}W 엯]T+Ix=mlIѷ~|,GTј7o`sԟCu4БKcPo̓ 9MM남{ӷRnEwonK^˚;,wtwMZ5º'vlDng:.ֆe~G|=e()>~wSC!`\'X8e=oCRGgߩnbl&aC6"}(bl;[A6%ĝduLǓrgW}a~72Ih19d}l '.](O!0-xE OeW3xDmA-s;|3.{ZZ{1ˤ+XWɶT8|w;}=|!Cms['~wږFm^|:!NVzm9LGaxVof4sv=L?l=ɁCIA"rQk"}'KHs3 :((ckiMi< s:L78^.t%;R`IRL 6 SoWhu&۝K*E#Ibo餥K%^͙FmoASEaP3=[tGa+WǚZUU{oՆ^" 1Z Z BkoX[49%u0 ݶMo.J}:H~xxAfz=nt[^g|'2 9ռ7xGʤo7Lxeȩo'H1-Gjk,sȀpģ z?KfV&-<&=c09| !찲p}IiUi)w||yoi'͵N慃[6{a-(1))dnFw=n?l~oҡi7'5Y52IVA;濿ܨH:vP)esU3roR(?kgjppk?#hz^$]J3siV+F7tjD9<]M;NbOi>q^*yqg9 lS~쳫F`5%hOdz5\.'tY& {gT yޭHU_3E^HkyXw2k+S|ڞ@l&3omsR`[~?DhZg}h]H6Gj\Z5բ ꉩ>' 8s;e s5fXZWnilZ=Ggh{|xHy>e)o#z.GI(|y_K}&.SCbA[,atGƒO)nYm2 ٗZmC7G^=[M|8Wo+8y{ s˪ELJf3:j ޶Dٻp)qAP@wBe^@#)!ްͥ2` k^<_~wc;>hڍ&if4f[kz7EA/W4?C~|ǟ`(Cl`':;m#2333n|C?= X%>r݄%ן v7Ч8*9#*jAN FuR7fWT" 1fm;Dkd>ї0fP*лvXwUjdwtW?C.dI$n\s7b8uf У8M9FT$$AAۆ`5컓_Ov_8'IК:maE/}RZsں=炎Yl|x@L1F(*K{\[e5dmb;o~'gW? 0\o"ЎO)hff`̧2E2qz_/<~/Oyqsi23(g|>ł 3Ne7 37g+%Զ0=P )`["њ CNXbsz aHZyxުdb1,nSwp?jO'q*?oW\{#0<<ܥ"' & Gg|/KIxy 8Qﭴ,nF\4k0 o{x_ϣi l =#2cRܤO* P.Gd^ajg{gqzy]G1-0R f%=Uj(^n#gVd~+6@OtaCbҁRF &APh !*L1t¼+(Ovs9i >t 'IT,';SeNt7Uy7'%B۪jɟL>ubgtSOgoy:>'O_zOk`5P?I`MREeRXpNHM"kdh0091aY/v&D뚭WGv4}w6[˟SbOp8ka˟^۫8jhegsWg2@LWnۅ w|k'N 77ĻЛ(o>O?f.?C#Fպw2AZ0zy| q;Yiy- $sFۗB;@d]}B6=b_.x'O.'W{YlKhRqϩ7*;O *+-Q޼\hOjEkZϚCdXCoY[] +I_'dDH2hUu8it$ݳ;_VmB\hWЩ%QƉNzo2lg9phgs)b+sXzk A\Tv:oVBdi*\~VrUX lex%Ƭqz_]<oOɑt y|a5N;8'@ITͽ89 (uoR~#ؼ1E$`)h/4^ٍ0#m˹6O1CFpxۗ'$ɾ] n}.-0L.:?X8#lؑZ)bMQ|S/)t6Oq]s1 FY_brôIex52XޘD@IET p~6#gAOqxgaAhy3ߦ`ieMϯWm}}~[8qun9V3׶Lh*jTP4 0cB͗Xv6TGӠ1+a>r}GBse8Vd8&70DCXHXy_v_/"Olk-Shb ]bf8h% &槾IY ա`9>綀c Nlujjhn${BGїwRRkco]﷕ _v/c5462 fSR3~6#]3roxI0;ֻV2h' _P۞iv. ,ErX5%-G&9쒁9^Lt NQ@q[R)W#ض/-K ]Kjpjp+|41S$`D3}۪4f+1fp,>ze *ćO"YE%2/.,ɧ'][&2!R+6vmhƆ^2Wɴ]de Y-!,prHͶbA&f)Bŕo6\ٮM_\HKmeИXNݯ6= ઴|>34V$ 7G/&R\lbp mƯe_KCF/ق r[?@> ^<_èWB%Sٽ%`ȇaպ '_c++S4Jpa>&ʡB$~FlPQ,Q(( z.dK&>||wߍ9h.ӡ|oWE{5@oύFh|aTvD&[Zӷ|TacfBbm fN۞RHB+k%;*͓" H h#z4ߣDrz#sBpx,Kؚ6(:?ũ~q22vd+۟ bZ'ؼz۳SA"q! L+s"%{NzJ@OGz}5dmv–_?>zt]^ہ~!:P-LYU3j'[jN՚4Sbj" /!UT$'/Rf)0κ> eTu1zOUB+ @CFnOΎ8'ar Bg^D=YAw["`(c522Pk{pSDE]{-=9h2SMU:>˷0:*er'ٷ/,s$4g \H9'E@PT8t!<l?[&xJ4vY20`0fp/2I﷑5.S-%a+c,jp6ױM6H=ObC5'Y8mF8'ۨ$2DP䔥mLÆȩt@))˙S?I]i"n%4%($gu.)8@A*Sd.c:/LǏly}<+o_j; >&ĠCCDCHM(N=X܄d\>!UB ]FۅLGrYZ#0\$̠3i4֐t@ y `Ȗ1(W}à˜#j(FAf煜L\hXA R_TxeKG!fiawAzZQp%ZdAxd(3CJF 7$a9suzy241sM5߻|9za9p$͞;b˵/njXQ=~iu~v]ztg<CTH)InfKJü°4KsۺW #mWo 1Mkfm~3.8^扈W{O Ӊ:f`DDxiC :Ֆ4RGXU[+iLmT;tXW8m,Br^]ZA0.rݙd ڣĝ2'W ۷M#01z.Хzk9,<j՟qLH2Ǻ7+GC&(ܛa)19HL9ߗ@o0pɶj̹9u}5t 7m[Za'{+v-I'|69F< VOIa-9i|hX+NߡfgL[ߣa&Udʃ`6۳;y3$O0A" тr3pc쏕,\[۬@/hڶ|OsWs7hej>9ֈ'c;qfԀ1lqiaՄ&KVcH~~;c5Ȇ Ǐ#Ew@|!s9uߢRwY*e~Vp =˷,./+њS,o>͎ Z̛~>;`G pVFZQTJT2E)(i+EkEQj+hi(?u"PU~4=Q{LPG_➾|kxmyL-wog3/t2{_OwD)vcupǫ*|sӇd.1'9 [u004CU %m*B%6x 1٦^e2/QZ8ZQ&/#{ٔϷz$+]euWθE%u4|#XM`ą[R69) ((0jS@a<\a YG˺T~)eRZ#I4߽%&%٨9?>fQ:e\Na-5=>$ʍyQ>l68\a.X$##_8xlPNʵlĭڢoqg*OMvmO^I~B搧1f!ܠb<^YgBY>|&+˟3) 솓gq7x_ ^-,{z4uLă:몼9'pݒI/yY]ˍ9>]*bQ=PȈt`}9>+ي{ Goؿ͕b\D%r1~](`1Z,"GZPE#>O4߬ ._(Ȳo,̖]bo|`,xvgvn6c˿T9BEIfyw[ l9 ɷ޹}+ +h~>>|W>!ą.ŏre&'o]MjE}$?ޤv946ǘgxTyTAPk]0GapoW95.ҘcYIZ~E J xŃ7)$bq`A#Qѱ-})~<$*-AxFgOSsWȕ8@(xY%$ W"0'FVܲڪx}?; `jKs,IًEղ3Q: qRw!k?]<7)pJ䂲Mɮ+Hs(Q"}E[RX-!f{Wn~q\'H#-i;xo|k}u):QBtKW;=QD ȞpƂw2Is5L, *îjd%+˴K *K͛/*tpрx+pc47zudPw#ÇI@z!̓$Gnxׯ:A? w~{@B+<`L6P'/3Zf= "&E1 og.w~Y6Z#B3=4$kgJ+Iv?b0 +s: I'x蜮wqf9Цk6ipTWu{Z A&jA8krImb@|0 r3 aRC$ȄS3AhI36PG_ iZ|h2E2˶Γ!tj] _D>xKaZ~$hWx_?\ :p25G6J)0h2LsS\t5{mW֢=Z10a&&Rc5F6 +ykV'\hdude %(qI&c|HՓ*h8Qk F03Prř"|1[{z3>/$Dr#|8y-&"Vh(Ԕed!f@ffl(^8A5k֏ek`d]wgU V؎HAaџ~yórTgUOB eT`Fk(]]ig*[ӕ :3+3\0B .Gt 'l.+بÂ"Ptrz%(I"oTVդ с*۾egW[;ebNh3\%Y.k&dCӠiS")NW)G5oUޮUa!'b7]Sj5G=?RL騊=ZNS_9pc@\5 mIʌݲch3M@To3O8 /[AGt$&;YQI*(MY>)zŵ em7m-ؕbjPfn!B17Y*:G(Br6X# Zt l*pqrL|1Ē -$:ZЌy8I}V[Es&iZӌ0NЬw]'}͹mEԔRtsuDlssV60tQ8µ69-Ruoѹ}l/g=}/⏅?O=720{: ǀ^۲_ƳWR;kng˧]/w[n(}>3W~OKV-.ʮ* cf8[*}>#|1rx<vSzx1]MqYA"AZthLvL_!P;ߦvkv;?6\}34[UĪG:1,SM:l :W^ZKP[Fa]tV,Qҕu\)aiDZ91ãT [WTMX[mdrq  s re%dN{@jܢ8N#Jk0l'*9Փ$V5 e; llHT`$k::ʜ,EJY=Z՝, F풢0ήdj9Edӯ:J\oU>8ҪoX^u 5Ia'Ydg}oXldT(HAIlIΥϪ4n}?ѷi-N=j&8C)OljN{: '??K뿵k|ڊV|mLE6ӑzmޚ y, @1v`;/!ޚj^03J+w*z>~T cFG]_x8<Z,Ί$=ŭWOXu9J9߉;yU B,shT/n-|w6޳R}Oia4)kkrYbDJ-+,+wٛ?1?O~fNF߲i#Qdjpe6bQ)eRG+~71![ r[ZtG͸Zk6J✈*<@ vn1kkw@Qu61Rj́8h C(c>.!e#UJQ\R Xbҥ, QJB)ډM*eS{Xa_kG[df(R6YFMU k&"efK v1J?ׅ9G _q64ةYr!5x $ ҋ'|V%{IY-Ă#Dc])/9:UZ%fte X3%l$e9UZQB;bʺ?I(,AS:jUoåLt-%K_ڨY%1i|䳌$IƜ9#UD/™7BWBzj?ɀ#FQ-Uա]OhWRIkiwV@M0/LT` k]zaȽB(iZ#%YΏ2qHFH~1 )B⣧R ?c6]a)y&,h{k'Dsx. d8k} [O !V:,<k3utobfh 7e)Jfiq2x 1(Ȣ/jEQ3r\ǦXc,5enN?o`|_z7üI-v1Od/{ijyFZDZ(Oa#{ e53`+w*+Z+ćZ @$`hd@JMmsN6f{лqYξ" DeP|Dd=9X.)?ꔋ{(^:$5vuf!B4BΧu XeDnWVtԽ W=;brc9&"Kyp hTZH,{E iZ)FJHo.Ͽ-q٥L8v]>j($a%,{k<{vhPǣ!ԍnzS:t7~1nxiY@t<,W郃[۳ʨXab g:>JYnZL`ܺ$$6҅C+SRhS` RQe ߾4`V}A@Ccc"y%P1@.G{un8s"2P(hQ =XLr9&$ȃGsR@&8B?S&lݻnRqqj؂ff zђ1p}61s=s9l)[ tiQ۟4@RI^64̉$YzëCDpOhw _ߺ}uGmc?sgnÛ;gtV: WV/Aw7M-EZtC@=BC|3m}5<PQ(dV]&DV-Ȯm5Q`M`!#x4fпiLp2.̰.+^+AwG t:d{ +u;nwkjY6X,`dm? ¢v|jqҸ&ށ*oA&@/UʝB*%>B*!~"?20Ǝ4q4M٣[ǧh}D=-SlV\av`D8w^^\v-Br@*|_ $a= zܖ*-xJ֎g;;üq-wn/UկvWf)UPҊ iT^d4mxm)ު (;^EH9!Tߊo<ɍǍǍDzћ] TOkCxȁin\2dE~0 nhXdEeg'Mi얟qrU[1=S,܀S v̸ŐAYelZ@nk#3='P#J ** \ L;:vٳt^nR Lx ZO7za&nm|+)NK3 qWqf==1PIS$B2ׄ) _s_u**hSv6b,J!Fff*{p#}V8s- <6,SQ%h)9qjP/dE P0~WU A[n-gAبL`]]_/7Mh\ F? 2ɷ>-'k {;n{HsoK;pNԬh@ݳ^^{mWx^^;w<7׫yܕM(ljl֝(]JSrr)["_,B|; >Q`;:g5Flj QB@(@YOKjV<sY_NˠmX(NF2BJ"ZϠ%^^p$ \-5mE m 5.fU)Q {P$ vǭwpRk`M%(t DekNwRYcgN'pMsK[scNzִ-mu3;uv"=wme}+p P*f(vfUֶPc(P^` J@ 4L4h `LL4ѦC@i=14` MɠziLzRl)bS&24ha4h@ !M!4C@*~$jiқ)#Cd&Mb!h444ѵFS@Cz $RHM&#F7OPzF(jhhѧ4 d@G4IڛDh$4b4 =)JyL)e țShѤ~~ML4hjIdOE\N F Yc7ˆb4ca-A!I9 WcECBm&T&SJ C d ʄ N9Wk; *PZjANhƿ[{y_UR˲#r~65̾?\^V+,]#*H'#-ȉhPB2=|*$!c!ct&{7gmbT>p |=z$ܗͣ! ^?Eo;[cbRz/ "x+,?M8dpQh=O nk\dU>e@a~erR )>!Ø:yF3m0MgVe<d˛u@D @=CMT& AJrvq9/rZƤ%U)KMHr|;G-2EÆV#wu࢈?Th ( A|c]w px [D͹[qD0;73ǜŅ=88 t (#~ A,:qOYx??Tp9-n~i:ζQ#$2LiL KSnԦnF ŒPb]DÇAtB0 3 &*>=IE)R; ³PP5B`ǏmҙOGha$GSOy3N H^߿<4/47! Sڇ:͚D k r##~Q02PlL|w{{p2CLpI(hmaCz ‰H H,fsn2i\e:C&AXXNI/dgXff8[&&3(Ƴ!FxURV߹8*Ğ =EC1L ؝`K<\{٫hnH0@ ɀiԆ?S:lҿoXWÊu("Lpjzu@ ƏV2u%YR8У(ܓ.f^# 2ZzuwC %d_UXFmmێ]\O^`-7N U1R.W@IA$Պv$k͐MuFtգ >0AA 6thtUI!L!afŬ}HRգ#PB=_c;@s`{tKt]^`.=k*n0lf#:Qu?KՏ}/}H~YaLllU/X;: HC %T2)BE~O>_+_GBD78>T5$Vz_i͸uw] FϖWv4JSJÍ@@.`LtN;PB齆F$+\ЏSMq $Y-nU+ZOld˛5ܨuxEdzؖʂdT[|.I!&n8eɓ$cTolዬi=jg'bS?L|Oy)0#"|R C$H IJЦb#"=3dNĘS n!KAuǖ H.B&xt ̓%rv`PHI22䍂'd+WzArcUa!HfWDРAH@t6C[&Fd_!kUZG|ȕg T'>GP}$QT<<?cVqUlzj]_Ή@Z#ݽgd+PQ;D4$&`1h'W9HݦRΟk2d2_ДH m*=Xt)B"H'4W:/ iTNTEQ$]E8*$ 2P9 kNO5gJ^ژ 'Xl(*O9x6\L[i2 A(+ qa8ֵnX*%ֺ_yA)kYP -kơ ~%r}4ˀ ?&_O˕V\kQquK 3~K 3h(1` |wvOPJXbԱL)/TvӌD$ bB7K:y(B: $ԏuȲո@'?cP;8f\$;ڡ#: '~3qE{ȄS=da] ' PZ&J!S=o&b_]Ub<#_R`_v %MRd{qB1 ,t(WxO?v#D7HC0(QT9z8(EEN!S@tE;{9<+G[vwt3QoRy}v]PXѩ:0Ai1d!!9"10 @r)A3m[m+k юN_g i *)H)2 |`DA$ʪъMav&j2 HRBhDkjN %BRЏWQ%!BĀ@d ji[jUL$D6S<( | TH| L~oN VgwH^W_%\ `7V sG noL@OXpF#;Z[ >b:}V EGBDCzgyEsaJ$(eUm7ϐ0]D sw)JVBHH);UbHxSIJFWEeuy]wV_5um{ M)J"OoejQ]zBQ=L[h8gVfQO8vIQ{W0[pA00gϞI*&ܯ(!)Jr1 K{@^qώ$%A5SUPx ޿?'2_9hþ@̩#2Gl"H0`C윾^w2ucXtt@OA!\ U2~S½NL^kyH-VDz_L @ B'WAGtO@_QCLcFiK7U{H-BG?W7sӛV)o{@JgӵX OajU/xI(oh{HȤ~6qA{ziQt$? \1o X)07OÈĝvNPp/ l,[F͍TVpQu7Ycw}v#B#@0f%qF9VF @d 0AA *&LA5!q,حf %ޛ6rPrDQMo ٔ|gm{3WO+f3D…\98~ Y+CVPVDR5ێ`K x~B( )b*9RRv{ێ~wO+$!3d"cN|.c3M#!)(׍.E!֯hד{>y9B=GAFM:j4=Ct?#@+"xIr H`TC[qGW>g:u4;߻lm=nM;q2x,>XW>;[yE܉ 0w2huTd}z]6>hw @ "+ t:pebenD c^ReJL'8OoKqhhW0K @IA$(IJJ1LB;oyf*(4Hho}DeSPH-PN뎵 ( ׮ETtTrd2\)szo᲼{ᝇPWM)=`A_`]4x8ύs1ASy\zxAD.V!_5Mڡ4̋Y L")A!"nR;߂)A|6b ӱ`sB=s5R[FO͆]rtE_:/}mDѱ(8R(5[ZksabM75Ԝ Mx)&KpgqI%=Jg La~l?q=[,:Ϳ>D~+@)Q7m0;U`ac A[;L(#Yhi##E1yOwJRjkW[B@(D)\e@? ?BDdB# KH(-}x0K!YG;{~tp6z-1PASF04FQ6#w0nX<.hsjj̍ˈ7.B$Ȃ\@BSĒH:Nь( Y:Bz D%Y7kIq4A * 2G#=yxwKp2B!!tu$u`]lZL:-n&etntA|.|I? >/:c{wkݥ܌Fx'1_x0 d .fM;$'+Ǻ@8nj"/ ">T9~SѾgpQSPTBw8x*1S(qeXRxBHLg/BP=jܻŸ&|>G+;Gk}L, 0 ?_}|;n4}A| O+E˴mG>N{{5]^F?@6DlP+Ճ߿~AĄC18VIL*}{MqU=3#qϡüevUK~]>pGO@5?eSϰD^9'1q pd? 79FI=(|jd})(1%-o9lx/  `Gm,NInA7so8NCy_ASCbIһ3YN7*.Ǘ;>+ `@]uK:pɁ>1ݷ:\A"8;oEO`ҡA>{=M+\L\18?^}J늆Bv؜|cB)f17N ' -z˴b*@h [_a"I >GoQ.nz J>LzVs" z#f1-sHcɄ/7RKd]_q̰跇u,BaNѧĀgAsT@GܾD,a't#4  낇AUOϏʽnymO/ |i d>.5N!9][|AA <}: 4J7 ܚ Һ_Iԡ]E`A9ڭ㌜{yHj4b*H((GrkU>fʞ+y|+"qЎnСG/5aG/G.3wN=7T$dGAHh"R z(Y1',8a@D~VJ @3^=(17Kf<1呫ӷ,eYB}?6 ?> mS*z=6cɂ`ؤȳIkE7Pz=3xXoHYҒg'W)qE}g 69Ԃu0<$w-oګTDj)Ǫ0X dSpj \k *ndv0" #eu$Pӡ!G2CvjC0v>A|S"FFblG6#kZ&($uT:^UIA !P+(PGO a7*S\5T[y_Ӑ޾~<<Rx2_޲D2B\ȁ5=nؠ,7b@ R\>9p+~F~dHe^am)k.>{NExZφ r "sPJ"%! NO2z84vn!Z(hxMsq*GyR LG}\͔*ά<[t$+| !n Ӌ*߾[@wؘ5)JG~aJUr5T_C>!r$Pn @Gkk@&vwC$\PЄB  Ik.S vuw8|p)L6)NDsRQÂߖ1S0 W 9V,j4fʂTՀ8Bs(>ЁbNjTU8oAHqNCp"םdr3%6=l!G!O #]EڴD)r! ɞ8쉳Xi-q b6cK q#\vQR4)PZ'}1ʛn}X.XV;[4VcS5sDi_q"+%ΩܠpQTEkJk# 6 3"=^?(A]Tu!Ȋ>g A!LVC2 <@%wMT YȆY 8~c"8$"lAĠ kS'Y7i<`z$ 0PV (*nQӐvu d $ sg] :H&w(̢ zAS\$Ȋ~Т)ZQħ.x3$ ]n`60(% EZP:$(ZN9@>!Bqcl.ͅ+ 8Xp*pe"KC779]:J:pSZ /JDoGbR}KHV cw=t?sV{:eWPl\a}Tsr u!rJD ;]ů &ɛj-ѣxwm e10@5_I eBD(oU"RkVV+}D3d]@ RZJV*A+^qeAMQD D@ ONZ6HdI|֡JΨ/O.| C3x§d7"7f+v+b&62Դ ,`l('.kA hT^< :c4T\Ҧ}Q3DSw T:0΄-ȳ"x`,ъC\"-jPT)Bj JP(j (QD"i *"H-kn`HARv17.-4* .SPq"m. J*z_FQA*'"&?ʀ 5|}@4P Ͻ>></ _sz D򊽋7yCV3j.0L.Z!lj@@h@TEQ;? TRJ )LASyEJ=kf4޸`nِ㢨3f&|x{Iń% )BX:,zf*Qi B yX=$F(Mi21#!ȪuEZD; 9"(7VzNcoN(Q@v;:ߟ>q~&`BIh gc8hs4 GuB)9jVVpwy@( s B }}]Mm;k ߩ|\KPVU-zX*wq0 \T[45a k4 V%زhZ;JnDdxW0T1S%NoЃs% ! <;&0~خ̳,m?/&;kR3.-]^`֌,f)@]"?NkJ~*pQ "97Ĉ~4ז//K Qƻ_momlQ-}|J$^ZvZ:?z{hS hmw;ؙBev Ei;#QG\b%Et &w=Yk Vsk*Vl)׳6W+dk[,/aw{)ҜrTץ(r8H@M% ڊ)O%Cqi;}zpPtjlg;vǙ9imU3/DކbyrįoFd|0C̷RB1.¨ P6 R"ԥ! t&heuhT8{7-Z_Np4p;^iOe\(`/Teg<~7`:kM9Ym3aS7iߕT8 1XhP@*-0!C I@PPDBzUʮ/OORG5 N>Jmꄁ5rd!KJ[‹=NEN gcP5ɁՅ\-q9lX,kAcQI*0,$ ViD4UG!>R[~ߜ';WM#r_ y7It%C1QVsIL歮VR.j$ BI$&C ֚NHM̕V`f` )L@x)JAS@+{cnv]m7d۸B32%֞+[S&]1!K7X}5r_ϻWx-Ǩ| ,dk;w]cumE#Ff2J@TjBEh\Ƅ52$96+165FՋ`X2FnbEwbg/a߈?M4L '{ֵ9Ą!f\IgQ7P2Q-" lԒͫêm"U}yzeG_>*a$Re1UT3D.z1Sydb0'vTZjʤPةyj+Gɖ`ICXIJv yl/[릠lDu u <"jNH=q,(R>p&=B'jȉ:tO}h086N#)f6շ޷4fMMaRfQ fa2l`c)&f $12dLh4Df+"F !23#4L*$"4C1 Pfpn<`=i I5zv,Vڌ ɣHhM# 22YA`wG~wΖi@EFA]N,Y䂽k't ! 8 B& J6E-eD#UUS>Oa @4TE0DdĈE"D6CM&Ф) Hنlh&$بkR&s^;U"ddc[F\;SpI8pƸ mafrZID“ @$ Qi S +J 4J P mdHPt3:j4T? DD&V+ "y脫NvY WF.VyN$HL^7l!왙l9fHc&{¬TP MQ )z7eVwcQ,3(\Jr)UM,7eIߥ=]^F"$f.IT%D݀H e~8R@^w8@^@ȐKh2H S<3FrX݇D *FRxªOsLh"Q}03.P_ۂ"}(A~dEzH(9PE6W] "B{8OQ}"~dAH"N" @TLDŽLUD__{ ,Fe Y5&YYSMSSVfRije)dLMmk3YٛY4JS@Uci"i-bQT(D|td"(!@ d9)JJx"r AO>o/e`B|+ЋB (  /~T=2 J2T(QZ@𧣑Vh%!BVT$Xm5SlfYD14 ’B3RQ3SZMض-%RʩJm4KK)M"%6j2[2[d,0ETRV-)fU0E$FJ(Ffhj(W l}d)HHِxPDEiT)mh*m*Qcj#ZڍQ(Ĉ (=>RX~UpP@ F)P?9DE_{ D*{xOECH/ (Z}/ E)H~;AeCe=!s*2=́ʞG 3#0!Em3La+)1eZe-5I3m6m%cFڤT҇<$a }>~N?jdNJQW ޥ]ATAP/%@y_9lp ?*% gH9c3(aU"@&mxjkۃ em *" c T(De-rD!Z+u8Ŷ3{1>(+x}A{b9[{Rm;"Owi.[ Z~H6x92-|XIWYwYR1**#D^뽇K׻?ao**#QTTM!XȨOB7^ӯe I~'?!=n,%&|#Ǐm)>QdN9]hPQAGaߧgmYmZjzHAQD RMo{8으|6_6wŽ\ E@U{Ku/[ǿڨHJA6e% Ӱ^zG=6̼(PDPV.7OtmOjڭۚZ)DM-%SGa=.K~v{-Cod!JʽDPj0Y/'[d]۶ hbFƦ lXQ ({>=vԐ $7Aq%z7rͫK1L HHi\ilS[moNI5zE[>CnѿI RJP$CAMNۿ;Ws8C! @\W P_MtU E!SvSޓ3c@޶ RN9i&M<&ه1f ȇ}5^,J(JW~rg^1R=y߅yqmͽ^Now}zp8j.8;Zy}V8&)^1_/5sʯfZm|=Q ׎r>_wۻҼ@<AÅ=U-^-ױ/PV=Ռm?fͿ\cRyZ6FA˒low먈+M8?#m " JL$ 3J?gd9tqI¿<鰙.Goa趯%iO]xf96]z#.[ėQhL,h-I.MП˭[/?g_>> Á_wbHh)ݣAC:Uc}[ AN_/o}ߠ/!(9N|Y_c"%0@LS%F |K͎`f''\7.(= l2pPK cI $zBf(Ȃ="y8P@ 2#2@Q}4YP~kDzV+NU@WPPټUyg79ϯ=O~XcNzבE5OGl?+|:&S?¸n@8" ?0lAW-~(=4}Ѫl? ODJIi(1_%`+5kK$7/ov=q@$uzQ0 a :Pf|k8ڹAOW~v|Oɏtz/I dgwЖԏxL!b&%)B$BEaa?oVUDR~2&h)gY|?}?7J=_=Wr4u(f;S5bmI G?γgQ. e;F#Q$7 jơE>آ6*|Y{{1$opq[JO<t*]D\L3D@]9F֨_0l C>zf˛-{o^t;-w13 :YVVEaj^ҝX,pax<; Q @@mЉV_1&p85:Ȭ7,57g] v_ CS"Ou U5(`ؓ+$ONWYY"A9fn)N `fT6enQ"dziNMNkF3qfuVni{h,[P%# ZȒ2mRhrrmu\v'Yx\¦yNDV>I   MIQ""H]Τ Xu$8>& p88'+zhlXbרDgȊ0rቡ0@'ubT(R"ⲳ/#J ȬU$3LdFm?qTG/nvi[M(SFF +ME^-W1\ "̙eZDVY3ʯKZD܊mĭKPUK6~VpJ?ඞR T^Z")ABѭx;H:.'K= 8RV~SP@ܯ$t4vBvdm3#jÁ d3R+.5 o_.3^Us;XMI.a_«>+kwrKI!9ˬ<ޅj6v)+REIm蠪"Q@5>L"@V2'PH G*vMhc,I ~HJ <`%PET5 ({i2?"s`E~I;Xb !/S9֏ku)ӵFfo&±mٳ~..6U!>h'q u7Âk5ž.5#㢎|W1O@яx',O9&-٧j<[[,0R%I dBSİr2 0Z֏ʹf&I2rG a|$ϴF dCVfHɷ "O|]lFrh^P3sK4 @ Tf6mEQj*5W25yzkə!@a‚#W iZ-%lj&kł3 oRӽNCGhJ%2=SBb34]1b8`VVXUUuN궙^R:N r.fэaO%3,m 6Md#0rHˈh6#U۲cjf)VDyusbb_ā)Ō2ZCH_#h;x(kd0qϭ7_Ogq_ו!2*E4T ,tL<ľ7pRɄF6iFTJPPR|ӟwb1mA˦_Y Je' kC$2 S]͜M'_ǿ +/Q]GPcu-~ʰ]GߡOx^Cn2{zkq74.-HO32T(ZJ޲CRJFZ&${E+3YcT@FTj 6ƫ%Ekml^|vd4m猄x@ MbgRg- 4c-qj1Q EPЙ1 4U;C|z5tѬ[hcZ2lVhMQ5z66 C>(jE));2!ӴVtRFǀcIC/5x+Dd\6.Lb̫TjhVk`iB&6%TT .(q6ؠ8IIQɱZDa+Qm#J+4EW{sMy^kqۖj-F fcY-Arqh~3tn] 4_6PJ,鶴@ !V5Zzr=:,hVH2 YBڈ*su:ىS?yEN+kd1b*GR&ڳ^R'i-=A̬$Ԯrp!G@5 ! bS+_7*eu ?(ZPf C!ex,ЩJ.@QZ x qU_=sC5sɨ떉(`]Mճ~"Y釶yMUC0i) VCsOQRkU%$y4$*(Wh¾kcdL{䠿[Ko+o0ϙq%גpnߊ."e==l.N#:pP|W_c<󬳆 PV%4kY*BImd(r$"}L7L;\c% Z$Z y=S;|1&%)\(SxuS2 Z R8.ro6 Fj6ݖV,i*K}oWf]urƻ ДnF D3jL wa%kէzDdH֤6'ޜޯUκ+u>e)I!(m@ġ Ly>[o"5*>cwtȭ_j/y![gƖNW쟹VԽKdګC¨ Ä <]IԺ6"h/ubx:.P:0\GA_rD3@+t.Y}3"؊"qD~4Do "3翣yUCL)OuTR!䅇֒|E[{8=} XKdEgP(d$3Z}Ƴ\_(}ZI$B$$ȀygQz.=y>Z7P{*;c,02ʞ&nwvoc!(I'T|<>0{z?%ߛ?o -R~6B^xIota(}~}+'hqI`^a-> N2:Hg٨Q  y0s_#鸛?r9 ipdELܙj;uq> Cm7sH<t9z~w|ϥǽ |Nd4O7bCRX1U%uMO@֘q0(*R5(d̒F$U*h,mԾ2Hɭ&w+m &TKbĮ MaiMHdpX͘|:I"f-%Y6š Yh9ʸ⢣cfsȴQIyqm^g!pbp "! 57Ӆ ɨ66sRUQI(G\z- 0 >N>^BV.[}a㓮ll/)"$"V2X6-F`6cK(%R3F6`֢@S_+kLk#AʖB&lJIXѢKDEVضFI S(RmI&A*4l,cXډ6)Mb0!Hĭ#]wk 4-@S-LD%Y0bQEcRi5%h8+mr&Ūyf`׌ھ~Y*At+Vp'Ek%[IRHՐ.:..1+ .bRKvκs]KqVkYXa`Ňnv]6-^. IoyLo'kvME*]ݰ& "5l5pJTEP$Qi5Fӡ0 [\6CwޠO)h0ٕJ>DQ y?53f F* W߾'[gk'=mÇW- puvd!2пbҸ>s}'dYFw`^D߷ktBʲKiXR' )8HmSWD&ri6@/&o@v{~FɬJms?"LZMՊd _ o6v%3M?ȁHi="HoWqbW#K$yj ^MSkS_i{N5 h 'V}wl[ gJxP$icnp.4dl!l%P qM5vhr5%jDqdDVV2rв4 n>ds#94 iHYwHVޙ'&Jýom' DbPef/ Zxxƭ+3ʨ@ϘտKY:mJgԡ(Mrȍ6NJK 줠*'. Ì]t9g6~ܿN^)]'t /梭jpf1v;>]5N {yr +(-ĸ:{l~t8tm=Npuka{#LhFx59R$@24`0~Q.vأ~x*H-zm\ %Bc{y%okXz1f|lc^L@.<äHpZ̦gj P=9^:0V(BRncnJ?@r6IQmg ,?/ y4T"#W ~@[u/^Ls~ΞNw;h֔) aA9hf>CjRRP0<9! K~'Rm9qloBZF!3w_@F^ 2d~ZsUjEŜ;[I|90h|;^陎,e&D̜CIc{SZjɬ {ON4r{Ib 0lz [~8F[iz֛ӭ@Zs$= OMۑA):TU (t=!U*jukǴQkB>)"B]1[XÃT%I> On 9H$l3e|b_nlDM69]'j5c]giW?NwlIOH¹`$0TP35"3es>fin,o㾂uYiYBn'2‡(uКs|壑ŵOqQ3:y)Yٚ+qY #j8 & B ~R:q5({$cJ"4 .Q1)n]J%<TBXq<)E4]r-ݷ5y@V q fVAc-6HuRl:Œg5U-q 74 ( c&(=)#c#ˍTiZE}=u`P`#K2^_~g7$fX*-7McKke3 W4rUT6hNn6G&G{8n UYPtL܀*E~~Dg_8'-I}}G?\Cb@"g%?X l2䧆Oðe>Ď߾JωO/%U6 g5vaByIVԈVE ȲnF&$c-|R-D.X {S&hR駹j($5;U#c͞ed8&s@hLe'&zacwz\{pƲ[) ԁ y/¥0:z۱{feMخkr+9m?gPr&&]%8>D3w]h֬VNy#O )4 9W$qkxԐ M^}`gȬvᮝ)킏~Tg؈ZxlF3)>7%+2!ӧd ^a\Md3% π1i`1 ~|V`nIP]7B3iHLgr`Z|^+ZN0C%U2"6Eӗ<JS3!bAB/XV{ǁh >1 ;%1$X3EiЌYQ4Vح se^?"|0CpsJ!̗Ћv|ۢlr7Xwi3ϻZFx-^\DW6-Ͻj-ȹ<'B%P:Q[лK)5EÿvZ.OV>* ,8/`r ;Ve=@BD]ېOK'rE*ڎ?jD؈T:/vNF{-C?Mz֊R6\t!w-Hm=8Ei|U?E=x%S[!́Dҳh~9P0|Wk{B6flT̽Sf͕.saAyg[%(Ybx}MKO_ǨkXqA9dicѣYq3B%L78\\dygRB|_j⷟l>+͖/s=q҂H݂JnKL|{LUpΚ?77@OL1B(7ݘi )@Rƿ2ՐBa͙AV -56_@cg|'LE66&[Dk'$'ܮVmN[/ r]q]`bǁTH;zM502*:D 1N6-sड़qbLjc"eQ`Mi>R^4J6[@n࿣aqʑß?/ ^U=imz ~@2BBƸӀZ_)}WZ݃QM^mt@94bE!8V"Z OGsd/W=EQM`q^E@q_JnwhId@z5xNE#Fq$ %t@wp UX2z_i % (cZ? XAcC2m&2"hʹ0pW39Lv!lKֲ#)Q!7X"PҎ > AW C`s,o [A}jkȠxtM>jl _v,YZeFUJ%/#SJ6Vt ЭÉЄ֟NwI6&(4V+G˝=2 @MRfJUn~>زԐ xکUL;oKU,׏xbnT{˸v4Ćō5e}bNhхb{bV_fTù 56ȀYx™~d8TlD=fIaҶs'yDueNt6{k) RXY{Vz,V^vZ#OoG fxk7uC"|G<8%$;wLEvC7uׇڇyp!t/ƿm IFږ;ܒP ?|pLpHs<ӭOQ/@D뿂+̫նf~ 4@*DwEgRqN> e^ mh6{ʼ > 8SŭA pl p]+OύI"$ۖ]J~ὌLl>f>aS˨8n$"F)U5yd'SsE]͠hɋ$=Y%j#́\Lw@HIPx P'Y>Cs_̜M^>s 4*2l,kR{ϥ%>F,%%8<dsY VUrvtHO$$ ؿ݄pLkrŵ]4u@Ơt( *BDaMcia =zÃԛFᰒrd;Ɋ*~c7X pZ^|-O #/)w p9p\9b}ꯏ9TF8SI9$#}2x<)=N <g6tX7/Zwَ/3h Ep!NHy}'WA jeu/, \1ΎjI3׵KI4G??]Z-{lFVhjתy7k0s&^ؗSL{MPC{-߷iGBZ:H^"֘\D*GDp6VW}aӦ+mΞ">NKA:7&mUtz)EaGӕ!lg&K٥Om!aߚ;li% ,O :DvŤM ]*$ڸ7^rtP۸$e)Om(؇$[B/ ^y?%.Tގ:.zCj$:Q𱛻,[)x%d+k6"'RBWFTK"{Uޙ'J@3Mu!_TT)YPfsmRkJOguZ"LWTh=q6}RbJd$2px%,uZi1ji2&|ju)/r_(V q.KkWzޏ1!M1V>֣°FϪhǑXl߸~rL}d&y-=~MEFC7&W(rV !dMOTDX*V Gėa> ~zOD5SAsם3^LZDSR]XO;'A~[L:y$9xuOY_Fc깄L/kL'>= |XܩY= "|XA.ܜǫKnpֹ޷ 🢟(f3}U!'G ꦀ(Tʌ#ĝ$.O= OӨ,v0`oCh*u0`8Ϻ =Dg$q8'[!إc/C:[0./@]QPV{X;u8yN:.EC6gʅuH~ٲ?xYBzF8D3`2VhAG2QHJub';=}BORqeT ߄ly7K>+g W9!6ݼud}p҄&n7,voU% l%=@i&k!ަ 4n { VM~[@ jn]:J۫%hA8zGɕ3#(.7GE$XBNKU==Rw24_ͷ"Rث3 z6&?ͤ3:=.D+ s<'nb(^ʍlQEK"癮4E >څUU !X8B[Ū?qLy}kLY; M]9 ѧ3U4Ay2#JXIɓcK!rW즍|U`ӥJzp<|uY#_Wۑljy.MHzs_x@xy=Q,Տ7)z vġ-]֧F؜?F5o^Ԍn`L24Abg{h+dAc߇(8>s=(qif) g]ӹ&ľ4=__7Ss_5) !q~u-iiDɜCvTaDU&m}Q:~U͑yjl툶Q:8_Zo^!q+vrZ1mJ\^Xḧ́{0jf?m2~>JiJ("u-Vp%xi>bFk?lgNh9/zVLGodBX&ܦuئ(g>ߓ܎Sow2=S~pK׼2 4;E5Gw55+}.IJ+I&7e'JtCRX,<'Z/)}Ѝ >lfFKs!)5=u8?yT9*ʛ>JVNa[I8xD,7r, ÐE5<_ \! 'sOO.N{Uzʊ=r cm+w$'Hl֜I]\X]4pf,f1Pi38&?ֿsyKY,to7NhsomY8t;Aal=͋Vc zXWԱ@#QC n v;Lot߄5Pܖs涕- plIA3seWFV\.Pp̛;>Dt 4샧 Q^U4ivew19'#Rj O] ,4e|$z6;rc,3TX-KM A7-鱂߶j|bɘzTUef BRd/ti,3>z 40 ԫ[9M10S4H a >yx4aémcykt5 .WJ h))=js2vOy"^LqՎvHr9ؒ9I ,+ $Y&$1ڋr'YӠeYSpYQc<˪`bqGZy&FUNgf p^;o@IP;ɮ}0Vz\'#|Hc-Y5-OFtfJ0ŠN'M)a 3)n%!Œgi=4=|詽 5!^kZjMt9"Y>=q+ !S¼!w n#E\9Aܾ9"OY'Ol6`^ Q9=)iX3}Agm* #i#(΄ږQdDJi]; PMhy_?8 'Zx`qɉcz23riq=̏|[[[?-xS};L:+/cկ{ӲۀJL$snnމBXV=7|WY!I<&x'& %m  ~w5fkL0veU `_Gp:[5^tO̙GեOo T P7rS wc1N\j1;>0 ]vK% 1:C6&s4t8azg'ƂgM>~ɲ=I)uV~E;<{|fiP=(p?[#t;+k ڮ\2Cga~m #> <9H-NyjL(:0- ҌNX'ȻyڐW 7p z3h ;]p*ƹٽǶ:Mr" \Mvaxޙ;= ߒ^ϼF[5\MQ-@ ͆8>d}WlZ&>NASZjJĻG07DcՆV݋Z X|/W ݴl,.#4YL_v[U${v 1=lDф#E-Ϧ-\"&7щ UfRW Y)$yTEQQQ9Q gzif5Z{$8EGbwu=BHp'9/J8&ROGX*P`{89Gؙذ~+h@O;ңݑɢI+M]@7 A6sKm +[|-?D1zOA}i'!eb !}m5M8zwtyY=:/Çho 9y eb/4V,5Q"X?OZs8K=^ |l.K*-Xod,R"\pYU}ocv/wWa{RhzIcrڢu-o0_g ̰cV$SM",,u|ϯml!Pmu;1~tz/XűZQ]$  [q !"u|"n3nq^TC.@ox 2) Bi==~ZqD;Xi/ RnMK8nSz! fAW}j5iX$k DCG~s[79 ȔX5ՋÝ˱"f=P„w"=Fҫܚ( L/DHqEyJR~d~toL L@+KؖeCV*X4M˗^LX^`#Qv%'j틷6ϋ&Wt@:hbSf+C#Im}C!cDZ~aiW"+w %8OG)ex sc.-!WՃo͌PB'}miretw_ 3-_==VT C94֕:+cs%eF@3XUl95L)5"kЀgIKrk\W%4؄Kg" g7.?eLY-7VC$¸$a-Gc𱅹e SͿD&N$ v!66D́T$^?0t܁n5VECPn 5uYOrJ}*KNC ˹ #J@W>#aƿ5tiZΣȣ4QspHjsƾr,l^IwzPxlB3I}yO84Pog%͑V.G '`8Mͣ!R%%q(lUnQY qW&3HqGZu.U 2|~AS$91g8u/d UQnؽgUHo 7W8j?vv3/qqWHD@X?/=77Ye{uVҝ& I!vMl53-'ɑEa¹cB#(zHY.*/\Š|7Wf;/>vsV!5aj,& υ]v7V&^6nٽ($׈V 0FѨ<4ҌoJ dwũu~vk9P8 ?e#ꋤ7ʞQp*C…\ND/y̡:׵Te`ɚ;#Đ;}ȯ^ϧAok`yidt0V'';r \~{Gd;w~HT. iGI~uiQ#{RõOiS1 )UqFL햮9-q1m풛qP%"DȪC,@ydr̦tb:3o ZkdJwA L# 5l1L8r2A!!.[E0b0DmgMKY%&Q+BG]SU.3Vy1/9` ng@03[ =.aGBq,'UCߴWR22 J=&ᰚUU CZV kjVhCJ"yFRc{"SD17GXmmY Mm,6g;x{k6("0_#ۤ~\='7@oX gs4Yd*L@Wt?;}$0 AԖ"hBz02Vpqn#kaOGZj忝ɂiEϰ\sxyS`HA1q47_Ob8oMʖf XwƁrsED7>Ix?6ɀx5Q[;eMcTjB z 5>LQMYD庚Q$$Qa]}S?JsT\*$u072mQdT<}VA.e.J;'"yR?N Z-D:T jN l-Ct5"Sd$r>IO`,F+ӌr ,XPǜ<%Z8[9ON3moz1bJ8p$e9B x8)pH/dEs@aye r P㙼)vW = D+2?swiLh@oLĦ[*bp0SGh1e~m9-qI]ː]"\E:[1V06$~N)$|DxOj;IR]#VFbdAc {OG-gMhE]. h7?q>Zcdl= 51HSeq՟~::jfZW"po8 8(c~N/4-d,7pbjԚ.Y.FSd w}(KI17@'a& kT6HEE -%{)NU-6@4-ts $ :_4 $lwUMǧj_G&-* \[ioV"?[c[m?5myQPσ&u *ݫxsaS +:Q9!<>Etm;d#d5iHUq#q}B 놛 ѢNGT:[SI+}J7/;: pi/KVvoc8ct(fKcy;Z(zDk 9s31_á$_^S .\?@9f?0j ͍)|+?D+Z ډ7ldHeecv ׶7=8y/‘@>#+E{ gac"5濤^ 0[@X_YYBP y{~3bcsT%~/t|>=uNg)>AJml#(J2 &^ EmhPDV e7Q] Jޔ˿UTR\h;7@Ҫ„ǻ[ZUMKb*R!"'x$Recv@g 9Ǵqu@};,YyC~v1J)3E}*ϭ̭Ibo>Y*Zq藏%]Tř*Ұ'nc ճ_Kl,Z(!ddh- ^ժ$$ZhT*Ƕ;us]6^JUumo۰AR˥_S$|Sc^D>0h$h=gC.7_/v,e qŁ)!PIęsmD^|@1 #};6;} @"hWź<~}EH/Q24?ٔPX"QaPz*hvNoI'Jӥa! z;_<;_3rG~rNa-53P#to>X Sd*r-+xc'TGlskh=-`%Vy22.Ό)6"|jڱG)o A>I! &n$JVHWW0zF6j3,[&]6 8ˇS>?` 癄2`-0^EK /"޾~&3Ulx&e e P/M՟ThTV!j'1`2'\RKv[F;"N'lL7_.:s j@V0*-~.i^Љ8a #ŞLXrTҮ!c%pI $oA74wC9Nz]Wüސk X 9o:$MK }B4$8@Z~yyМ *S`w?crn/20v:/Y:.JիCIFCMϛ j _%iKV)A-1yn$^#Y_Jk,zӒ\)kE+H{{7#ivgNi# ?&sgqO7yb4$++R#EGaCc~]x'*X҅6=#ܛB.Y]h_$d#ptZZ *#;~= tl<zWM>֤8JHz0 S@ Q7w.:KMќ&MWq]O ߅<ԮD#tdn01v-c̓<b::vm..¨&Z΅3H|W;Htum 71LJО4wV+'4no?R2fm_L71RۄFԶ*02\^ 37K[Y,4sఋF ֟ty%s"^X9罻cM\*{l6me2-// p'&wwوw𦋖8%5yi ۓqsL73ׁsPssa̾D b,%>3>GA&"\ ^5Гo]OZqٮF$"O^ GN rjCoiALeU7p> Y,BJ4<>AX͞fKpC  DQ5HvG楯=:7+I!bD;j$  Җ*MR}qN >&נ+ 'yz0|B^ RESfYj͓^MuG-NF{#B7.sƒ]UZA+1\0k(u1ll&LybRpY g.[Ty}qQLGx*g"\do+$(Bm TB;0\˹g&iOmV^sh~`\,kgG57IO11գQ:n QX5 ɭHM=0Ж;vAbR%,I2RF8 :W)a;C|()_iPL:5u\%Xt1v'mI 62W V$wut/&m51#!;,{&"P$|BB95(viZ VfEM?/P#ae5c/H/d3iE(툵QǧCyEЦoP5k$E-$w[rƤ;qO WI U~تwoGOGt|.H>٤-?M|RG 6Lk9C RwQ?qQW OF ȑdp`̟6@/G`Ɇ0KClaj rY껌/zhRЉaB*PJZq@sjoͮU2 Bߙ9eGyQ1/π6/7kn}N3BId=oMaxD`{e3}[֒Pw<vBl" yE}p8tC9BA@ 9؆u8` "!)U0I||`^ !)r ]WMͽqQKXа8l'qSB t;UcK{>(OxNv]6jhөC lPu7O<oNs 7ȿFwۆ/!E(N2lB !J~NpZb+ћ%* uq <5~YxINSSkj;eµj[;“?}]DG(nj|>>wZQA; rn%!26g/i XUNU abP8mC~h2rX)H"gf8DQ[!(||u;*H/sk@≒n& m$Kд!j1 Ht{eA9ߵFR>'N~Y_ RI0/M<@Qx{rMZBGOuQmdnu̱X@9Yԥx<ʓ|gl3BD_jZL;mε;.=Kd/$\RPO-?8xsN[IZXrB O5 If+~gu6!SkQ: ^j#6:lXpmOJ }3mږ;:vħː/V|6M%i1LK#| x0-b'`p-` ټ'}xqu6~ǞDI'NGU`Ƞ] 'gj_M(ʛ^UcԒT Mspnb]o& Cɋ'lf`[Nԟ ~QS$qssߐ-PvWœD`D]j(M;[B ː&3;:Rh;j'v/-9 "s}$@R=;s}誧 ʊ"vw6~ZґI&dĖ۔頼ĕ v6|?){kcl^|{bJ}'21v,r$;dcA%,@+<n5?°r'&7fڛ:\O/p: )0](`\|0F|T0ۚ@R$3_hSFhuxD519KJSTL.iw9hXq(::Ĥ?윻>o]S9۳pEf7 hX{f3Zq!7~dc'k{.@ۥ8L `ϝ>"[kkEIVTwusœ;ߐ˄ඝYgA&UZivy=\\u,e~F7&,|_] 3=僋~W :LE41Q՛-GRê7qޖ˪&]{xk/ҩ_>(U%d `$B,6쵈Дq$Y2UΜ'\Z![d39S;/6V*! C \ƍMg?5xS ޖbKȖgt YI4g4-x |bյ4HWFŒ.\|(ȾS]M% -N5TG0X?xb aիՈZBuqLA?i*ZkMvA bvnm IN5\*u]@`M1%T[o5]2N C K>ض&yQʉb(At2I ̷7jT-`XZ'^k*{eCx6" ^MN46ij߃FaCfm`?!y!00JZ7Lj״Yr}w/fgbPo[9!10iʡEc*6b2PMuؒsQ${l0&Yx-nTs{lsWjE|J_%+&5>5[V Z">]̪/)ߪ 5)uj= 3񴬨fF"`" IQ)kv45PX:\kY'\f2kdKO4hPp[*q]"`4vi!ei2-PωV܌j}_ǪqUU eij1(DXs+ykT"٨/En^_`2|UAP2?E-^mʉmɯq&K̞`:僸 [tpP8sn 3GcpIDi3xshc 9Y٧NL|G55틒ᩬ~ ə:(se[͡-#+`PԐi<\}< ^E}v湻z>( ᑏ*v,F3ES0c 6W珫N|;)ǚϕ^즽qoyfji짣\>_ec;ȎV:y,a7x>M˝(gk qVnY:90%/ ˕]!Eb:;5}Ϡw'eg2Vٶ|+ꏷ5޼?m$4}:6}̈́Q7%{%e|F㧚!ewA-޼S^qGy˼DnU@u1U)_cVj{ x UCr%`ͨoJ^QM}twB'NJD 1J9z!j 2$H$vD䃚R[( AMWNVU6=6N?-&!k`#ħLPVkGvś$mdz嬗v_H<Ѯ6=tq`rm|]խa0ڸ{ Gxڔ$J਩6ڦ T􋙓cQ&C$? a(z @O^,L¥lKRr716K "!H$9X# cYƒ02*8QPũ> q#$.l\9@ʭI΃Ips`JI&bT$B_xXq |1фIp{H\*ԑ5h 4z˻UF\OɻFHӪt>5mL@Gձ2!Gs hXxGVi$GtjHQǻݢ(ZncGp|pXcxgR-9[K/䃱fWF/_i*.؅T`571m^}6ۧf"z8LPda!bj!Y- 2aqpti;94T"#3/jde,||,[\?q~_(LxgpFs1-j&j w٠Q)@ҳڙɿUyV_8| `8$6{)`RawW&pO(%0ytVh}&]gPuRK#Jd7KlYӎ䉕^x0N-zq3*gjTֽ&b*rL$ęjDyHw{x 2Eʆݙy5t,7Q#.gZ6˜2k`dy[hb +hm<>i%gѴ#u{t8Or$֓rk*&5rk:9\umGWg:SVn`*ewQ)~Tutf6]eSm*:[k侳וo6j ]$6~nzˁ;Jqx8V#,Dd.R SCśI>ոɝVqT  1(;Qfȋ'E>0#QZ){͜0[~VH|V~"1je3vBM3p=/ '5+- )HKJL^z%T.rRB_?o"a Ԣg-X1^>m%6 *E]<5N~e{v%"_Orp1i[׍XYP!G9 7Wb%験o (!=> ᖲӲFDᖰ7*7-**{FONxT2@BtC~04(:Js2ނWI](5[mcM}~ޏ'dC) h nIy:,F59˞*Q+Jyhc/#kid\yCFFGh([O@Pdn'rH\fR|5>)r^&7wm }CWvl1au<6jhY yβ\Ǡ tl'$F_& &lɢs)~'.c7|^*Z-t>(Q\Ɇ)\Y[=N%$[9nΞ )*tNqڧT+ɸ;*¿;v.G(`)AÕds9:$WRI5몬(2Ax[Л*7A萗Ŕ YV3*OpG\j,3 "BkK 9js%/PDk'w4q@/tmӨtZ2$"DTz~՗ϻs#.IJ@][I?ah2jM l }՛aMCxvE94](?Nv^1\->k:NX7|ٔx ҃8Zɓ#l@/ ڥƖ)$'s48h:Pn'r~Gcgݑ w*[5OڋZj'Ɍ󭯎s1{M]%_M5-Ʈ (B-Rğtn02^G'u7sܧ5Ox8XIY}@ 4L=d"6)rՕ^ʀ̣ZK*z?齳ݎ@K@}dN dܽ6i~봭F9\LF}R@K6֚P9#DÓtIH1XRb j`ߙN(h$Y܁Qff4QVCl.L?^|ck]i{ip+97W` +m*򚰛WQU!Mbl{Z]W-iE*eHAu͔ gN 4a߬ϕj:j M`&8'&{ڙ7P6=Kw.K_}j-9$< RĽx>"-7"o1Edw t,r}6TPwl=H9@x5bYw8}wj2UùXbx` pAS2 T\#x=t`'D?wcC{%TzWL|zܑ艄g#"%2=;f*"a hg%/b9[wVa\ hp{r35wԿK KJ#x]v@{_i"k(ݽ۝!py3F13/jUI B2//Ct%<Hj}:ehi,I:;ixN}$?Fud_s/jt~~Y 5ԷŭJٛ$J6tTm #˖?ٲxMz:x'~v#֙PhbVU~Nb# }rJU11WL`mK|iAt2mrCSK31(RCSDd~ʄD48fgRߤ,˞ oxڼ6@~XD`KOܯܼϺ^dtTw;I[!k[5>La٢MOIzӓYO48j8fןoPOǍb[&\Zf7Ge6!K܇v}KCZ~Eo>Ƌ@ jPvUt&qdL%@Wv4C>/*z!ৈo*y۫+¦'t;=$႖y/aB[SR5rhN㹒$6 ISp?28XMK\RԤN_MRIԿ)CvmcVKQ#;:>W»Cc73zxqM]Q۟i C:;ZeȽXb}d%Fofrb7lҏl2J! +w~s1SUj6IEOʘ4Ҭz{ж%1JWK s7+9޶Y{zKH%EJk"rJ:'9|-X_)!kꤞ#G9aDxclq ~X{NGYb,Oy S ~dú`4XŬ!6Cz-#߉BX38Z٬R6iBm BE[Jc#eTOZ^=b-m3n85kp7Ȕ˾DZyMX0urzc^q',?Nt$ή8aC[; "GbQ*Є\Cb? `홎Y̵:\o[Z4£_fӀ2pZ'0&"~&Rܢr1' &FYurhJN<7D+Mw<+ RdtL(x%y^dɓJ{k:A4}['?J+Hr~F{΂a#3ur~ 'IB _d;POWhpvb9):H=hJ Ic;5dV#:bd1_BA*Z!8Zٛ6M,D* -cZ'S.vUFs*JmA:4z :O8>g(khV9Efgt 4_̳\, VʒR6xahK$hU:HsWyG!REu&l{xފfْT.^B0#O}" h+D:TsJ(3V"HGP?u|}L p,&!}WWs^ d6hZuRQe_ l0i;,y(d/kENN"Y`Pa~IxKy!Ge ;^G{g 6Q.E}|jU97[g{ Dl+y Q{o[ŎQPd㛔NW=8J32Y]!UT&j)2 )) H4HTΩ ,$ >^ZnAwIt]_F| "C{k2-'t&KWDР\2bXj[]Ko ~Ob.xY=k%wN6h ֊FI%+ג'NAC+,BN >Oت}u2X> /L\_ڥ}Һ{)Ŗ?0yy TPE.}4i~RڳlXR #<&7ִ{fstk revh&%M>dФMh«?5Z9V8ñ#>#{9M~l{?UI}+ }zo_:'T #tK|'Q(Yo2ʢ?kBT)@Hb5dO%N#S9,S,y>@$ !aلl|"_ĴÉ[éu3ޡw,|F ﻀ}uI҄U+ ȣo"xCY+?_mvR&xƑd3\uu~m=Gq7'󱎝H U9/RlTއ]~V 0 C/e]`®cϏTuu*GaӞw"TgQbϳ;=_* C!G~ss4Pk"Ï#Csz9(R~ր!Dǵsvkݍa2C^/. 6|6#"JSD)n߫c0 q6Y9ָX3 : mGi?Z\#7nBM -/ VUv[M?MwM@N5 Ud?~[Ƒ9`0< K K ^LIqg;jDt<@J+| ޾y;rKӘ@|x\ʨk!' ()n chS~ Wnf)'OHe@oY'`w@J.o[䪷D7c)Mr ID*|GW-ұaʶ C}W-*Jw XǪxX{'2Q \nP|PtqLJB!G16_R|&A:w [sNJ:7G. +9~`k` U PM9??v4cTÊwc?)b0h2x=m{ fGw@s\ݩen. XBQj읞z,2"U:30UJLIq+/_@϶m[B15UT9cA?)WXs齻xo )gg헿}XXH\m W w ),~YŤQ_)wpT쮯~(_$)3x)eY0o"zҧ+Nk0עET #lGEkn)}v#.\PȘJ]pUa> ") q۪Z 7;YFHw2w;UaY#@/N(/ZZOٚt ]OvE,FaGš ־YQjӷ&~T B9{Ҟ\!Sx~p(ϡvGa REꢹ0MeS ^u`Kg4v m!%7RYS Ff)lU0af sItosas_Ր$jKJ=j(h=9nJ2[bUJN9mEj]! c$#zA0̵mt(r]S/bĬc#c3$Z:9?dntZ.?1}! .Z$wIQˌ!(4A#܎p[ i_\~/3sX19ilv\ʛX(K~=GR|/K;4HdX#} GpYU]T~NH/hio/;j^= K_-4pѮaB3"pE ŅLOJM5تj[K&us0[ ,ZĀ3+xGqtGG2,:vXW&ČDHv ٍΌh H\"*O}D hq|tE)Եֈ.e˿k>~J-eox`&{M'{ہ aoL#W~M5cC zU6ι..r){դ*&'R&#8cpW-5b}`ZhjUn6бNJײDc͡Z0fĦ/ry7Et-zD؆~.9ɰgJ0X ,[\;apB佫M z 3c8e̬߲̋+ VAM8X#$ P_+B[?-櫵{~A|)fH8rH4ɵϣZ*yg@Jk&ɛm!'YX'57 G~ϘwT۰HU,Qw-{'sAH+T]-]4[g/T]K?|Y;}U,QG`xˌ7 ƈ bs YZ