gvim-9.0.1040-150000.5.31.1<>, c3p9|qkhRbʮ8l/jTջlv'04ðyrjvUJ [`Һh'64ڈjx9-JFXGmۤxǟG*v17[Oo8%Jz"#e[:B0$40yT ]<9. f&$Y/\5 xRAYXUvT=hʷIiSJ]ɠfk+t)kB:gPT#6c>HL?<d  +8<HLe O  X      8  / h//DHM(Q8X9:>a@iBqFGHIXYZ[\]0^ bac defluv w(xy5z8Cgvim9.0.1040150000.5.31.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.c3s390zp32JUSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttp://www.vim.org/linuxs390x/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiIr C&F,A큤c3c3c2c2c2c2c2c2c2c2c2c2c2c2c2c2c2c3c2c,c2c2c2c2c2c2c2c25b775d6a78e8b52ea7872af571a0f92ee02b4344b25c09eb4764456746c68ea6761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820196946503aad0bab7ef3fa89e74f9fd44294c1ad24aa6ff7c1ee428fc43b8bad970f2d6483d137ebc955e26b69792aabe094867ae21582f99c008a146068fe50508795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0bd203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa097f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f22b498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.0.1040-150000.5.31.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(s390-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2)(64bit)libc.so.6(GLIBC_2.2.1)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.3.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.0.1040-150000.5.31.13.0.4-14.6.0-14.0-15.2-19.0.1040-150000.5.31.1gvim8.24.14.1cR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhanceds390zp32 1671443329 9.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:27247/SUSE_SLE-15_Update/1d8bbe09b502e3e6b9711a0f720dd0b3-vim.SUSE_SLE-15_Updatedrpmxz5s390x-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.1040-150000.5.31.1.s390x/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.1040-150000.5.31.1.s390x/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=8a787e8cce10be09f62c78992a41a84319ac2f92, for GNU/Linux 3.2.0, strippeddirectoryPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image$$R%RR R'R#RR RRRRR RR RRR RRRRRRRRRRRR&R$RRRR!R"R PPP P PP PPPPPPPPPP P Go'Nutf-877575ec1ada6d875d7e6905857b7a48b65cd84f878e9762bfa462610db269a73?7zXZ !t/(]"k%{J #(\p2g@V. VݿN=b緓e~#$-}}LS>hCɾUnPJފ/$Hx2AQV&ǝ"D[z?VdL5p~ k\G= kY'S"jX u30IYdQ ZPӌ):z<~2w"~H9I-`B,nݷ( uNI&oz㔞:f@>Yu渠!iO bH}֐! f>?AoW44*;KB05qoldlgjɊii9b I9A xPfqV bU ]nWrciaT;̷}ZATǑz'PuӘ† 1A/Id)J_|_^. !\jPyJq9JuY-e2J 8Rf?Rx3kRC`ضoG~YL$4^9x@uhi޲A"xw#`%Qs|_'kɖRisf[eX*AWA/!tO]N30=zG.;Jd6j]Z7ԍSB-Agf0"|׃ ҽ둝)cl dOdQ1S\Ɋ:j cM&>tJYhwR8gw#ED26e AI?nqLKSZk=-l4- $0{2Ki٧l4#Ti7 3|I&lX )$LG Q$6% e?+1)RqjoGCw9+_ƤGvyRx&'A8E GfiiO0>ьyV_7 ADPv),ijdcY ijsʬo ";W/gu3{1@£u/YI#BY158=0/yrj "gas*HʅVHsYb Er99ˈG;8G.錦Q'`2߿Rnnd#EiTXlEdM~!yǽM+ JUP+Ơ;Dm:ԑ ;kDjCLVʋYG|aETJnrk ʀ˙-TMCyX5W^˒`&0=\@ MG1K;.MFVi5 .Qx@P@ӲJЬ_"kO(wzdxUͪn)ciM\zTe M^mpX`i($<,P%߅8\xqʁp 6ȉBߌA<ȌMaf8Uj){so׋j/CNoNlaXD^@{nsV[u$6q FRBvtfygqʍF{!sȍ^\W.O.~ T<柛' 6r7(U\ft8rD>^G$KM~2b~`OĻS vBK)TsV!,hP~at]L=p(^MɱX9XL5 m+Q A)IE<R~q |M_ge,~pflr.]@-2Xg =0V7@$촙 v*5(U fbA0(X9g&pA gp`"[BF27e@U`+%Zyft gaؠUw}78-_nցd+ 0ƸĻݓ']JvLYwj5{3>IIRAoܞ!OmvNKuJ),6,Vܳ촉a'ö3,'$hϞ5#e4-K6ـw2|K:bۯf_FTUT!tJOţܒF Nj/ 68ƤlNL/JUHՓƼ51TI+$`M޻ѽ^I93R1; 2O#O445^|ԪePSJmp ̑ޮrh*׻ wиHgclK?` drQEj%@DK%Ab&ĨFvZ)gj.?]3mJ'B{hlŕ]MbސD0Ai??@9gxb(oϪֿ_(XP䷆hI D xUo- @)ܖOK|}K|%(S>A8 hpe m2ٮߺG\.AxbdsoBhd9S]>~X3[]A:z<( hFe9F^aVl>cw?9Q O{UBks&~50${p՞sPWb-( kM$TAgBS%cwvHGY[{à@T}1{!.:8YkpJ_e?0 !_Q/h1wV:2vnl Jp2F\'omp (r= Xm\RjH @5ַ%D1T#TH WS~&ޥ0wʭ}A5Rb5+`eB\>!: PIHG#+x$#́trz>MKv5q3p:4=HGK\ c]4Lѭ{X{9dA5?f!NǍO8sE:r ".\A«IJ ї0UX&¯!D^~}g c->kc{u)1 " Lf J71L#Ӕ:_B4Pl?$M(e[iOZKw0HS`DEo>#` {K>PI4ͽ! `y5l`4A`=t}l1z]쮘0]iyXY?( ln={AK.@h95 AYIDځw޻ƍ:G:AZ_Y F1t(jHEn}qESYHGp%jc0镲B,dB`6G[ۍŦ g_nZL7tQ,4Jp.8C~Ll-ahxiՀxy"M tCd^x-ռH/%b܏lBgh5+~MU*ф1ҩ `mFay>\V.ߒlBm s$[Q@E+.b ft(*db7% !~ +N& jlxHQݿ,E:8!JIV"TBU;0C0-T1Ƞ627A)10pɔޚ;8Gl7ϑ )"}[PQj ѭlMCdIEm(.4V9=z^9 l*E$ezY }uʥ.s2JaQMF VhQ81 u枩K^m‘hɼ4X-oCTP࿮^~ӹ`>I:s?DMHe.S爹1U`ngi)lӅUQ9@K!c2:^"XJY5 )RDÂVO0oOBvݷouFbJDoEE\כIL^xHs*4fs&AS~mٯJ/RX&QohzUS s`l(:]W(d~1`ݠ] 8 a:kHvhƒml׵o;q`gӭNyfxV[˦#gGKS^ WfxJjImL հ?wcW5> wZ|L۰lj mOVø&w*/G6+(Oٙ )zEBP,ˬPU_ /rg4iшKj|0\ y!-MM@>6 7Yش1gՑܨwĨ0[w"|+;\bý)^"/_`Tm^g4ĸf;و z%%d5 }YV ²YeW'qxY;ZxZ.K*!-lbG;7#+?h4%f $x%Rp^%O6&wkE|w&O dd\}Դ/ZH=y8-^DJ5pY,Y،PAKоB}Aٱrf#kH6rN(PUX&`hG Y7n?Rgu?'Sj `Q.|v_RF bWZF.XnZ.3}t!~- [.Poa{jԫ\;,au'Y;S Cx>cPg?nƐl#uDvË(bJrON=|v߸3;*0ϸ6'6 Z34TʁaZO1A%aHfd68#)=klY:;3nuXtT 4t I~ad.GR4Ebꎤ>"{82kcBsH J1֬x>>oҎbݤ?f Г"bC- -WO+ЍM Hp26" V\YZwF𺆳?Onȩ+,vsB}gf!k%FSP(BJ+DzCmk/ OIr(AN( ܘ}hY1n,=ڤ=N>vg $LnjMo[?YzTQ<ХDb- :gI}=OF`[zp).bs /8gA%.T1$Y)xXuEW\ypK GvrN \؃DCy&)X !(M4Xɕ(L. }Эx_l+/GuZ,xN%%Y* f3' ژ:$sۤ!}O \wY?/P(ZސTA^!4yBxHt?}Fl)h0.0u@s`j5HWu`I͐q70zZ6AvW;CX!d6kh+snGaϩ2^[/kl%[S,ψIe! L*-, uE4 %<- E:~)OKosk&<Т l,ңt9.}ij7o ;/sʨnʰrTtAR (/)zPd $wYҎ$B6Ls?0AX3 v0Lbݠ:gr4[2|t$F{;z|P(au3M#x Z4VƔk~䙈e 3$ϓ!1.'_#Q#I5< &9 eIu]ߪ` 8=iH\ijRlɿ+,JkŒVjF\MM%E+]'*$]E2^4d7Wp[NYWw! 7-w?9 ?xw=6:1Lwo4%=]b_iFI^(Fr ^ y0{2Y!)԰Mjª"̔ZC!r65@X]&Gƿ`l'ME&ثE<)*JFZQtd1vmX.&Д~B3Kql=:G2ֽ3^)ʂ}V␫a" ϴO#;u NjV0" IBwfS25*)*0sj6[uzS*m|,(\kZPc @h}!ZN̷gIgYx?װC]GISW퀈8 Prm6)̥rO5 Wu[/ ||@o%=; F\zu[lk3d<2|<23/}>hqf Wώ_Yj:<8VYOD њR2@WK[J4@aM40ؚ?$kh3 y ZZI.i%=ǟFԋ< /gU;@!!)o_軰{` R<4ə $[s"h?YȨЎZVt* k2YeEfBoٱ*zqBmڻ1cu>3=69 Gs`-$xzKB}Kyͼ(o& eeu:է+`7IyOߩ5ci%]:}-1 $ಎJ&Wtx9BRX.n˩$)ִu 88N yX_Ev35H!+`^7=QY'$+EۏQ Z*Έ7g-Fݦ2[yaarAv~F?iji²N J~e M nKЊp,J"S6<@:eUmedUȶ1 %ղ[C,bBBc`KՈ &ݥo!OL ʞN1$XMH0v1)];` BU7,QdJA}P_8naVq +c]lm%j6L}݋bsV HZ${,p;f Cr%ˍ5Zn js 7\%giSo *F5k$QDCy1~o(R[wʵv[F=^@amS A"fU&b hȅ_X@oWU%h"6.bP$TlA58R>tȶ[/&ָotºb{@ܤxfϞ}z ϳPDg:_?P<=wamVLʗV%rUhh i=`^NS^>~zB: 39wXh.[-t7c Նۮ*J_Jn{akrc9\$/WX*0of$,h/@@2"l[ Ӗj|Vlɍ~[JlXmpb.l\Z@C "vG?D ąLxK⣊ hjk͞@*}isvA%Fw 60:Qml ."?:3k'۷ -"T55sEiyj7 V:yg~Weɜjsnm&.@NG1_[ѯm/C;}kSEB^UB)FS% DNdĔUJG+7\]Eeܼ箊7Bm!'@\Jg}v(KU\e1"^!$wh(M(KӉ9LQK*8Lz~_1䯐ѻJW\;w%UlR1} ]8f_|Qwse?k@\@]RE%!^U-5#hj2PEUTÓ8k(^:1˵?KJKq8ZдK;XL' }Ek/R,r箛j3vjNԮRiCI?1w\ҽy:B~L`e}B*EBO9lp1ۘD3e+\8 BDƁA4ۙ;lI?S;KD"绊75u.?\d* T=Et({.NɿY,࠳vu쳲E <4FZw=MVb@o6w{e}:_K-,w<,n26;fe:[qHwNtF93!0'O0D}VQ )9Ѯ%$7PT xIb9b:pP뛩*Zn}u[R W r=[yqNp͛utK)䠯t;e/ЈlR|y(Q/&2=YиC dqpqs-m:T>ş2hhMEGj*V[!Ij)IEg|;16B׿5bv^`O'w.zeT7V /ܑpiDNA~'~ 24V5LAo(EwHӐ*V3L䤭k9OZU:¹ Gb Ύ9j0teR*L([/4ć\{pDl>*01  íU.0V!?䞳<ȧ1{s 1pZZہ 0HyJw\r$.FZYtzQye4yx׿-8"Aa[y;/9Ò_2*ϥ7pu#.}Ur#?4lH6o0O@<#'Si}U.7f{.FW˙+XP-~)]./;_Q&%:%Z,=U4$zKZFAA~}p itYâ(:Ɛ<,LH{~y3˼ZKeG o;X-6UG"k)S^R@T%hLLp:]˜bKJ.v:U$ rI[߷ˆTRpmyyp9ȓQxL_3O^#@Xܯ~C$o\̴;P۔ҰԿ`j^6 q#!ʿyofrCDKy2ý4~"F2ٴWT+luT4?W9 X%VwvnODS&^KpY Ń.߫c~!?MTHlRe8-tWnTLS쨌ΐd?}tsU֧9nΪ_͎hMOK#ړjf΀]qNp3i}cS %he`& 2/1}7@yI;46\cI |L^MM.f>3HVU(W+Y]3ZZ_Ļ3kFsd6^&NcĶ^CqWG6H{dC]^eY&bX8J@WsVG2rsҀUZ .w/T;wj`x-(ᖟ*8iZ2< Np&T1p`ǟ;_֑OLX֩2 5h&بrx۪ F,&h╕y+a}([i/ijqwg{.px>DDc#u)!rJmWI_cJ-9}F({Ƕ!80%S1HQ^@XbXK5ϣo"8";V;DrmXUVJt+eFZoQ5[9~6LR):w'!Qzd^[Q԰gћ kB9L\څJ֚y^ߪ_0?߅w)Z$x2Ë-ZM^[v]8> D] E.c3@f:=>ovnWשּׂP+@,0J3M/-v\9z JX-_+9x7~3'NGnpm?J3i~9̾& )zύȊ)YG~}h e>"-nTŠd@ Kꊿ6U1Ѡ=W(@&r* $J`EL8¾h ϔ;N2`ΓT$CZo|zW Wi~L-eViWҫVo|~jH'v+k%ڊu i>Jo1d>FH[dV'0G󢥓6$#]{vwܝ!̑U|Hy@cmEZRlyqp#IXUeQgFo_"(4"n}YSj/bDMRгRhhe"ѹ[n,#N!-?.R=\`޷[R kjI>A'5E}: 3ףTԁBRU>]x VE0#P=V<ɄM>(wYŢΖM*t++ ݹZ[$ErE+yyKў|AN/[)$Cs->fMyPKA ._I2˩^7U3jLXl4!B F+2~pO/[uʍ~1QI+1g9r%)- yed5 's[g_.D0J"=KKjDjc~QUZ &3E LIfBJ!dW+/Vscd,HmRL4$vVB4hLY5=L dJQQi73"\)K#VP~xA$huӋ!;T BPl f> ~}qF]AD;UVQF8 ]H7#𡌲U@g,#.o,1ȥu $4A, %;* Le%㛧ir\fݵI 4AnJr \buP<^ʰϪ~pU0d:BWMffa)ηxi'ZB+ArhbÎ#7l%BS`fp(VWBD0gA~F&wzwid.kjZA47cӽO. 0T$F'*&Q<XSd:贺;īyo%~_>2n7EΪ֑$0L )+ bڦ瀗y8'G73(< 4-ym!,S$SbSJn>2[ kA4DOYQ%s=19zHidYVB#CCh ~h8` bTD[Z9?-)0 VNSC`:8wDf cO^iSTLZօڴ%4U|h5b(hG9^,`),նWHߐ{м$FLK,*U~P@;*ek?FlhT a{H[zo`L$_.DN1þ.|E BozD xl׶&zԵPzJ4zΖ|0f S%Қ<( nSc^\*|nfCoe7i׌q.QA^c.CbVǪghSDiJI56MDNKXm؆A KOzS|}96/0(1M:?&wh*qbD5Nſ0ibMRl*x_zD{Aa(g51l~rd1ZIl*ZMLwc'S6Q5V*HCʴ/@ _!HQoX;H|D%RD(dv~D/҇i ~Iy9 ^XhI\R,{1Z±Zq3 ~mr)+'%2\5Ӡ xs12-}Fʸ#b5XG9,+!L,)ht1 ܯy6I l,߯q T; 10'v'^SCkحRkh}!m%C01BI<j&1\&6JžhUn,nُ5'SgП.֥ۂtIGU5^Lam<"@8ֻ.ߦ%9IS:iD-rԁ堢lMGowKE͌ Xg>v( ̭E^W,yǬv"Fi~+%BT͑ؑ{wd8Q^4GTW%kN6C`S@40{Z2d  hăm$MTaY )*.M/`9X@҂t3pvlp}wʖ/W3xb;ƬX ZI6&= rP} [X3f*T<7F"4[ >M0 .B% O3'D:A󆈀w1֥DIhh&Exx*U57ڷ* iU/()E7bFq$dΙ\ NnJ̚ݬ\4x,f+)\\$#?D5IMZOlyg*x51Ĉ2 4ĨT/PW%}ȄTn3?٨Z/t@ɝL8T5߱$[b Qz QJf'[ịˉ5'Vj },}k}2]ʵ a(xtVD2eXlf"lx_ue#yj)(lPjÛQ3mxNüf d k BYE*n^x~#bg|#­1si:tiӹeőg]o"wi+/}n7MuE[{7;ʈ|?;זT ӎcQ[  p(#ntRp2ĢfK J h8Ftx.J_Qh\0^Mx zcTQUR ˫cU"{IѶ Xg̟TK,}R3(,4QǃM7}'Y%L),L6 E`UHЗ7!Xg?\I5,VPѤxI0"W2g2}?@U`Nll߁8l, w[ ?!ZdO<5ŃIIMdٹv^Zc9\q6-p_+IaxCw|6H-J>ZK`^7rŐ2T!IٻԪvkMtgHpc5hvnxDk&Fg3cB§f֑B|H_ xX;ye 9(^k\TwnOu%Fl@. - l,++r11%դtu5R.I_+DVSM mwQ虵xwҳNh6ts֤ l8-l) k&NH W.Gi?Mبb[MW2'!p^[~tW#r9/o? f"ŔFLp}(\0rRs ֱO &~ʌh(9kG5\ILo_"cA]j8CpGs.~za;)xk!oy'H ;Yښ`m9C 7s u N:BE]3Lx1a) SuR*2!]1V,]}]]:niQ1w/cdwq DcS1 ft ̠Fd) td(obBo]vLy/Rd@&X"7M=M9}u߉@9b JƜ/WنbIhzJ~؟UӺ/L[~ӵ]?ҸGDB5uԺq-qx1bUri`jeX"3) +A+( tKBfcS9bEh1aW< <Č# wzqLhS/Ђ+ށlX<~(Ay5rDm9+B0QfSo+ !7DœBWC/|^ S'-gYYmđavB( bȀaRYab:3fPX_?2,DQòXQDRoh,0K']wڀ^B޿qNm{b3yjIn>"$P3 0KFke  h2d) RmWp(sT'qoY J W*+[qVGo,Qv=R{Bf a \we GD5y?}k8jp(8Zij,R;)Ҝ DV)VY=On) /Jf2iWAIUIH2[Wk)3{0O+5|Tܱ E=r}L'$/D1(գ̜Mt|/Or0F`pywB7Q)̬i$sX󂨦9xnUk'>CYSU^?@p0S ch#puD]* 3  ';=sMKrt<(^HIG'&mwJXC1i#8o 7x?zyoTK:pCcu>,r@ͦϽ7c9. HPl[um%Vg{3]fWE\K֘rpֵc* ֆ(m,A87]$?X\IՇûkr,' "_?Ek=񸮔_T.ܣơ^Yf8byJoM"ɼM>PGKs< H dgin?;)Y9ev)!9yJ3@+ IlTm2]Cz'oiBrnE;\"UY"t7'3 :\gwsᎬ "q+~V" 8xzb(Ł̓"MJ ɚK_+}NƔ wK=K@3;AJu~ůUyF2C\r׽5R)H}0?\K̐f^z򄋎WH7!=E'ɑkzCR([:*J={:QXLQ>w$ǝ\pZ:xLln~YQnWycCJKl2Gv3d5UHJ_@[ C>Ww Wjq| Iާb sOdNr,S)U\`N7~ȗ0DEL 5EW`Ű֌CQKȵGNۊ >qR8yfUhE7횼5/s]9iK(#: uD τ Yι͵P]k)$ҊrOlIO@U!va)2KĿa#ױDECH}$WD{fs}맏T tt2[3wuxc~K蔛e+q6`bKĤKyB]#qN@ 9v #X崔J~,sEZB{oL#^l701`A`jA+?*AU'/htE" #Ĭ]r٪ݑ6qtCrL7!eY({"x FmTy:hgoA WA"tj˭$HDrTE88QCM&Y_Tʫ7$1Ӎ=0 ߎfبJPYΥ qw %mBC،xy0W'҅ЌT5;yE^`IćVryF8WaؔK zz{\&!IR1Xg4ݣ+?O\f~=o=6<[S̆n-uZN '"uy]<#%@pmtF$`F%N.Cم)HceQ܈h~sI+P/ɓLdFI܈d+ĭPү_{r ϪmRі٦;ݯ[ɿ]ect0|$p c*@jCΎ.DH hNgGsK;L?ᏈcF.;d_5<sD&J$~4(Qj}V[%¡( YߥyD)-߿1SVJm^fM4/ mRhy"Kdr}GQ-A;jO~nfʾp]YcjjĴc<5sl5%?Ma\8Ya܅l̔T\iݳEО?d(3CFPB"ʻ?9\^1'OXb=Va*ec14qΠXZ3 *R>ou -9OGoE} $5“jmmۀ{Eu&~n8*h߮{+)u~H~( eGXaݠ]kezbJ%wKU?]3MRc|=Qޔ>tX) |I뺛n.ێ+Z6SUns8JT-oK.E cWGhq(Qd.T{f_TBi&))L' >8* ^n q\yHtAKiI{ U>w21NUD(&Uhb\"Ut$]#sO`J菲,'UHꋸ#n(SO'ٝ^6`r mT@peYJE~;?(z#S}`69IK3 r* <}]" ' 2Zurg1<Հ,d ;GԑQen˫ʘ )N3؁_pg A}5½`tc6ӄAі8yJ}w(q%i?Xd }F3H7|1WxRcrGA6[G+f{mk LqO>U{m= O<ʁقQDF_EPp3+xmz휩RͦC=؜('I}'$Y!mmaӶ2 Wf27$mHOa ٕL/dLIZ>_9mws7"/Ha/aZ } R~tBj U sPQ̘6tKO)WTUkįWP;qV|UA7gN0ohv>z;)iCp'ؙ–}?t l[9+l4%OI>|09XZZkxua0%ϓK^#Q:̂Ag4yyM_b-^ Z2۔4?RmC鎾=Y>\>\TV2Ai#jǛ 8%pu1G z2}ӐȸL!h`2yLj!à:%6 H"X+elp BZI3!vY% u1gh)8PN7CZ]!+NT5 _*U!5u1]k.d`䑹 6. ȋS2k$$J*w(C`\S+@S3h'lpZoF 7_Z⌿Rʏ2} Ӵ=oڮ"1+0NQ(jPu$R[nrLk Eӄ(淐poU%nXOğW||l(•B~ziCmx!;uV:bP>o6@^a2~ Xzb7 _4KbMT6$Cm0;E=Y E]F MXǢT::2FPHI1 t": r*{(a̿󵺒M$+Vc0C68ENAVdxl5s 49m&rZݿ$b?ꑦ:sTZV!M /I[3Lpz)(ˈ RK]%s>{+ # q?Ekb2Ł>t!M*h;,ՙ{\8c$li\X֏Z`[*ttX)@N]_S MIZekNp8{tc'; EZWD!6*#S{zn`u$f;$ bog#s{[L{Dh#q K Ulٮ l^ A®w!-(J1V6~$dh5Hr[(pn J,]&а#Ɨ8=IJ:_Ů;+֫p1҆nl7B soҕ(an''W iż}S~ʱS"p05nu#}c+Y '70\ bb'PBĤ9~^Sz9>:J>f~Ǩ> 9{<=LoJ|0Z6=mUDZn$w"JFxv&Q.1f0'BVgY6 g=I%2M._]?3nd獍 ,1}z#rpy:V_Z? %%t"+@Yg8ӈl\J9wsfH|VR@+Ϗ~#߇jۯ"FY )#NE79v6؆^^:^O1 ^ }&"Jo[Զl'e%Âb ё ?kĀ9eKx`'^,$?Dr^$OO|xPL\e+BY)]%g%|D]98)dS&2{":n =uu{O]׈d7h -Ԓ&"$KRU8LcU>hykD_ Z:C(0 /EA^1gQ,kv"|=7:-3ZtI5hyauZZ ocj F Y֍ݶ V)Ny + 2/* ^n)>jDZUhM>DbQ=ЌQLw'h֤wn6&Xr aUo ri-Pu`( = 4&;JB[N Veh:,GmUIۢkG"t|ިE#wB#4GϞ7|(GCrJܿ=5N aIgK|.8uH%^2.UƔ!g_:\8<D Q>x: n a6@n1w2ytRYq͎˨nSrok@*?y# ]).سeFD݉:c&F|rCwW8C#l"pj߻"Ų|mvNaVpeӝ^y \*0*>dȬ j_M;qbM rjT+c*{ 8g#>FV3ь$DacIzHPR;12*j-TA"HCzUS],2}YH{ט̒vdtQ菠&HX|tͮw5 @kp8E*&Sx_zekQK ի~=N#l!g%ߥӁte \{c@{t߬q|^~^ׄS 62F ̧oa)(ː!X "\κsJvϾ<2kpZc΀`'!j DTzeT{|oJӴj>;Cd NT9 ,>%bAс+6Fqm)6(^!%$r@/nv׷&CTg~-B u\OE%TT~YVU j\Lvlg?5h_1gx(NAdiA5؜61o5zeڴN?2A2׈>=ҰiA'@ ^nq*Ҧ@ӛ́qwt&Y0"J9GlY@n"˽?-g&\FiۮVqQDvniT``fl+|N 0j=u1E8$7D pg+ͳ ><U4OV zPN Z9SO UI(zJD$V%iUI[Zغ3gb]pvԮm:9ȍn;~\x(">v[ Ѝx4,N~)ټ@>b(*-uj/ s|.H0oW*v1&?)3.RצT26l}V`h΅O,/39 ЍJ N#yۼ/m[j47b+x=e#k^qQEHڕ4~wG 4:C[4fy%<>8V9peW7.]MB+ U, ZS ^3ʾ Ҏ1´5y/fׁ -qer"Wd g3MBzV"m4O Qfw5QXp#K1c֮?&GR-_p & .4P'-lBPvl }Z epj&XvM?"FhwAźzpbpj>,],v4[x5Mq<\: !H]{V)Vg9y({ 08kޞӧiZ4S% lk"FCLQ Hz]8JFacUG;r( [Ei\f/ >껎 lT჋]͝$U->ykkhͤ`&Z'`oRm{^[B;" O>FIZI]ӑze4P/ϱNӨ0PZ|r^D]_2#}y {J' $XD0#G{j}>~ES}r.JAo{C﹂Yې*Lb4pZ|V2G:ფd, #`yy aJ^|IPTud'L;^<^T Y&IFt ?XO>`P.~934ۛT;Vs7_?9qyw.ZNhZ` 2|vttAà I`)bV8M4 :kG ߐl穴T%o*H!LM؂m-EOgcgo})'.nz>tH.K؎+L%6 k,2O]qٳF%@+|!73m2oDPZЮA1ĹTX*; w§6je ~>Wp /c,"ڇ cPO{1kλ8Yv/ p|Jޜ,wZKt"hU=CH11DKϥ@Z}T}H)EgE;I9oBpwel%K7뀕b\t1MyI>f()z5`I"zҧ:[b R~ <)񤽃DG Z"48E=7դ<(! Gٿw\D3YRfly `/^__R)_\h9i4Q_"е*vx]-U|d<!Xr/qt?rEiAYJ:W#~}L^O-[ﳎ5}|Xm[* /|0 CWZ׆ő ;|S$!BVP'SHv*::7: OKvƙQ{Ƴ#O?R lQcUYu3H(E`I+0>3ׁʙ]* Nz?5>bAI6 P̼͘xsܷz1\q6 I{2X32|X^fj:%F!Cu S$zHV`@ZaJ߱VRwPe{NűHJۤL=.͇/&eC@ۣȡs!:o!N`sxiQEBteDM?HVuQ&0݋9MoفX]os4W5pMX!]4~ ]h'm8}o>!O{ 8-Zՠ mbFQ-!^MG:]߭٨Wp|Ti:m7|>OƜKޗQUќ@b$^=G'2(ۙ`Úc܏o+ ђ|ӟwg--N@9:Go$E1 T4M,'zig p:1,*| {%ДA5sWv=/ӳ3Kq#ze-.ž:E`rP&j"(8n­H OߪOQ6Iä/;{?|4u (}1)㴲|9ҽvl; 7k$#D$Ɓ!B Nɓ#A %onʡ>v]3i2 WH†p!u6gS(u6$vQ̾Pp~T*9!Cl>f[4hCsjQrbsIH<|Ɯ5ɘ_/>϶ `/e͞3"ڹo9zogY'V#@?Cg#CXB7rZ.G/'Djß7Br`&b$&ԉwr_}BG\v!6bCG.Lʻ¶_neW),kԛ"^&1NZi>r)d/g@.p!0ѯ/*HJix7Ѝ"A2UhEE|wV(k\w^&af$vzPrt2!!¬5^}5x 1AqYGq >F*_|DQ}M ;غR(i kSpWtLwNֲql[{apM؋n7C߆br>E+:yԑ"~(>=ڳy`/:sX\ <!BNl¡"_wKDGQ= XS; zoR@t~_%_"fKWvRLv/0UCmcux FGl/-jJx%PHhm@6$I H|֤.!2kk)IwCY *oژ^jNzε.A-8htdqb'[0pDG639{EH0W؀߶GF5'j$F t=JFy]1HR6o F_5/5BS3Lkz'goԸcB3Md wh3> ~9.HmFiZ3gxM &$R>>pǎ~:&ҋwު%řqIrk+CQۇup_ǥh"W$Co']dǨ2׮}ބ](3IZ&zW~Fދ&J3YdonLXK U|5f1f(97Xk"⾪tk2MՂeF_#QC?wFѣ͕Є7v/2IdY\}(P^'A )G.ѝG]+ȓYG7 uu*hnKIJ]curKZGmE},lugy([ 佄{0ᝯޟxNLJ>мYgM.iD8[vSk_V{*%>'ExTs{dtNNI }4 'Zg 3x%{9!J j_χ${񱅫}|P0~2+*;!hTBUPoz +W9ژ-ocՄJ]/c_D\\Wnv$i 9t#Wzb%Sl֏#4]ݡX&]qaוvm>& &Pc5"ҥ?WNZ>HΝAiwvh͵L]2l%Wv2ud%*i6*Mdl4j ٬DJMg'(q)˟`z*"}ZzYMj~qC c[P9HamnY8^•BDw"K*ކ >u7z>&l99HxAus>~iNl/'AYn%)8`䦅ie,$=**V {srQTrd|~RU + 0zfM7f1<;iI \i VAKϑXz܎zp>  ^Qz&csdЎd9d@lHfAP&(KR}ٟIz+Y]ł QǗ޶\IUe ak:Tջu] rӚ _Mݷ;iKycyaˬ3|D2֓_U b*e  X45`nѱVTUaJoO)9*1-A4xd)Sݗ: VN GV4H $Aޱ]lr8)^'na}f]-, E䨣 Ć*wL|>!RE[lzRSVL F}ECн{ 5lJ:kzmݻZΓbFExq*_S ֌%hcy.F$&<< 6zVPR!hjQnX(ښ!Xǡ jgopeMdnD9鰴KsIuXj1oXgo˙ȳOsZ[Qz!՞,K{,E)qǓUH눤ʆErOP"w@ 3MKG/-S,>|˜:kβ90:6R4b[lP|oM`[lY +3A[!lD饶'Tp"n%ʕiw߿CK?/l#̉0p a¤w/Ŏqb59on'z1p`*pTCR{XFy]bSTJ7m<[ct0:3/gQJBB u>er*dy;Q_J)g\77Ra5s|ld;{{5o;_lM'dG ]_T4oS?D{ʂQсnFFhM*&W+(Ћ5ܟA+˹ U!=.]V~@CmzH^طD50Wsb,jݪ凇RhfCH2&ћp@REn"zΧJ1D%b aӧl|~d&!I OlukG4+i5mQ6v!,kQNRq i|3WfTt=S;ZBc*zш*k-`zȩ[f#'79tO-[uu咺HRaLfI+t gS43.$\ ڐ,^Y7WrJ4d#=6i4*HYdU{D9^3{xjbuAajo1Sb7tGTjch ^0 {qAq§nL*4=0[bߋg%CzqQ-F3S;С_g:Izz,v4g0U}0XLYwE@$Bw^>*@0|\CwƺfOm6h!_&A03&&m` [!?ʠ^ ܷx~w do*%1lhy24FhO2wE V&w {OdzpZ>OxOM6iL'wGN}dfnUX5IKW=w aHfULZ"+=.  niNO,VǭY196p 1 Y-Qxږɮ ᷋) [ohip pb>q.dc;<Ϻ9;Y,G FK˺?)ϫa ;CⶈJה"G'pq;lx|aCCo27<;U/iK17иo(𕐠yBI fS/^JyOG&#w>t`vZLؠK̊;9fxMb iWA5yg؉`TF $uU' 3H1F9quu{t?g]F<`RA<-ӛEN-=y MFso@}9OfP8{+x?qZۊhM\,JV@w|O )0vrE>1P'k览z{n G8IJWDC$P]\Bm3;c*z' 䑃LN_@r5*({I;|SO10t?@=XsNp'߁SVi>! BW\Oj@¯㟭!}BJEB[$^ QaYJg0,=? *nQkqk{` =ѹU戂5-Zz (fR[w .XLqvEqgfLMxQFEIm\(Ԭ:뼥@V/ņS$R80O̖ Pm2w.C_yç Jy+*>Вco]_Čm.>,헭1hqulw1o"Yf)`6;^+Anqr׎%V_L=L[C셄juB#Ìeqg".W+{2|*_/M5h~q7JC3l"pc@9XJ Kcb;FWubYj烥IC_Uzd"<-kWr~Iǖpk":v~dZ㥈4hdO"XC OKBz3a_  Jsiϩk>ܹeF& xo\ԓ!" 䁀#c x^⭱zg-@6^JڇM _U/D0z)RI{'t4PK3z$ĸeub;XB!f,j:)Ry4cb)|Ta 6PU;-ACb2H?*)d5N[Ώc?=^HNtOj̈́WE)lm/VTEl6K=rXgB.Sԧx#biQZ'L+L]7orD3\edO%ZD3Cu&Eȅ*kزPOk$aXTe2ܐ)~KP Zθ ̔Y ?b#nV8bQ!lK YkAD?˗5E 5*7>8*0@@#!J߽8cC` EaMaezG$9zT6gLFS2 ^?eqyiDhxRg#Ywhǐ3^?jyK,u~¬.]Q ߇”J/3pl^DK$o1/8p9ר dy?1tw(d` e՜+rR#|қrCkDʜgrDnD(M@aKF c![ ^U'o`UGTuVhXގ|9(ȇXO9$}f0oaZcgVП8x۾[&۔5Pk|W3k  " ЗARIw%@ҙl?75G 4fZŵ,0RX/9emQs1Rm5pE3A4YYFZo BRIJ|e/ݎ kCQjQ hM xFn 9 tJ8GDDc(]o[El[,hca1 Q1Ԫ%e0`L~ 6#}+qldD)f_/R>'[a!, "u< $>Q+ge @3CWjt:ZMrS!^3n ?K*8TCQ5mK7ָ_qUT)H+kLpF9۹7Ey&uL_R(RSCDOyoJu"* j 7;Nh7o* / m~lWuœWXL-P`5D}FL1Z tC\i_c%ds3#&3-Qأv%fTw%5)4B-g@9b.(}Px^_ғ2ژeg\sYV^*}g?QԃR1TJ}bdPMJ0;IoR{2I9i9?ϵPP 9j?fXP!r6d"/|,n r-H΄uhyܛAyboud3_['SNYd Uהȧʟ7 HտW/7ƅ}F"mK$k9,df Ss! VqkOTnE̊}߄ 1h!=ɊUzz֋EPBo_5lroUf0G[-FBu4& ԰k pZO~y83F "UE>kAeW*nwVLr zą C`jxa-`3B$PW3D^JD&ol7G&~-?83WPŽ_cM&BdN 6Ʀ)_wf]pM%&hqtr HJVl2ؗ *qm/6s {H7$pe-Eퟂ Ъt\U.aZ%*St=v-+`槷4qv~{Q 88 sOܷO{6R {픦a^h^bgZ8cس]p%?dg9݀KF4lɬʟ/o=1sr"qk#Sæs!nO̟bVn^e;CdD2%ZZ:<6GHJH@[~-O]l^J\tC5p퐓#9L О&']?rA5ew?kQTvܼp"x,av/~wwpD_k:W8ْ'OG ~0}\0ui*58 )G^Ak3q]]!r<[JFKO]|wq,!mQ L!IGMeWnvtd(eWYLMnC:"V{_ ѷ툲5f.ST%1#yMf0h/ ;UlŤgQ耄\I<%}as) B,l Mu>*IԲpZU+o[-@׭H_sl`Yc+9p팙#YiҾzH ;ZmBb2y2XEoqG1ԅV~5"`(3aΓ9C.qВKs[ vK19.>(An氉+3gE`! == S B"$+@" P% bvUI盠ob"`wp%Ŀ?'2w=*S$,?01ݱp$hzMXrv;=co7jg1.FR~.2'.:VH>0p׸2_c$=%\CأYE$z}P ,YcrCYvC ñ@,uYyaCg&ghXx_z=X_ܒ2M2Z͌KRq${iG~SRYUk!%Lgpd򫴧rz|Ekd^ DxBq~alP^CaXUH(&AL(i7l_jTj!dS(e<\?Ş WtJߴi?zA,C3y rڶD^ton 'b({=Ġ.*#*tS>fq'w ɷ-]*)4:7_cVUy^}Tyd?McS,JqkioHƒ,A/$. 9)NC$(Uj_kbhZ! Jijy{=])aKY ֱpY.}D2Ư5>0;vJhXx/lSaRc 28rHa)V3.+ž{Rv6S/SXY<uD Vot>Η6XlwW?b׃-=,FF@[~(R'Z8 e :!XYSul qTs^yZ?…ZH\kʦnŊohX\1rs UUd3S@ v\?Í6D7OXxy*nKwqK!7 J̼rnAb-;-:C)S$,DF]Pehh9bGԆfy9_sWĭ(8)54L/^j3CgPd俣{,"4`Gp H^ T?oP ̷@Roxj>N N/XAx@GR㖞,O=`G"a.cY 3hAr Bezg {Eq.z):S X(݇I4&H?`x# ?;k8>=Щ??6 !I̺)c(y[uU6rGi 'A$8_{$>)3 4Bu IaƖQB%_$L^y1~ ԒJ۟.!#8 vt-+8q\9PэKp*Yj;ތӤpέFjwEQslba_ {o ؟}}G|]#6@OTj{Όն# Yٓ^Ofs l|o9Pw$fe'%>~t}9УM o-n~dPfH.g)B+ wx|f&[jh{pU,y`ŝ4%Ԙ{MQ3m q9$1p[%oJ0JϏ| Q+gf`гs'..FfdˊߢL'7v=%R$~r:!Mq~ ONYs{kA.aUB58INgZTf碠Η)$9w S|Jl{x=NM7)|be}ELxm}0u[^3imX]]k p.W}j)=\AU7pG^A`Y+Ҁ~`43T&7-/// H?ʶ+"qUJJ)lx/V&x,)È)*9'==D~GdE4Ȋ(z!nS[G^tFa"mG/ICGdu\_mFnʜϡ ߡ'od"{\f,/50䌚c?*?#ϕ"JE U ]5g%2"?)$_PU++_B:̀Y =,q)>GgP5MɇAg[XjjBʰ Ն(e8c轢nMJa#L)fJ1 N^,Ն_ŗo*#?q[`H 0"/AB[rob8MR ?} GhLz`7FiMs A I:U;[Pmo4Ŭp ܑqX`쳝غd}&bg#5@}FzdY4zWEDn3:C&srœ]+*HȄ2P;K3A#` b\a%]!Ʒﭴm1n\Ӵk$I?}}GqN MKUe$a+Ac>Vl/x Jlm`/)kX۰BEZk-qZXM/$l<;4D(a,\0۝x{aafVi6ԥ5 Dq0t`'|f|x- %!ש^"d*BC티W9L@uF&沲![o [g'b±V<؆8C +[T=x!L Blj^w/*rw_q.S 0sPϏ=&9Ѹ`ϱ%ZIXZ.hG{" ThcD@wud$3s icx >.$ݼ2${YlK(A SvO*(G@G:gp>+Pu}K\0b>v-}ISLp辮eH`rup>\\#u|}Mt $K| eq܋tx5a.ZuOt3M} -!X18]Ù-f^Hp5jGCc,Lak$pбEDUd xKCҨaaBfnZn ǂ8/n7FnQбJA#W,W 2iхsD'"&kډ`9z~TqV1 : ?<q߻!!͸ۭp(V Ε*^Ers6Hzȶ`P{6 n$E{vC;Vl;0,ޅi ń"/SSs#44Ep,[Z/ 8a$ZQa(_PĒ$ꠇ'_i\/Th]#eSS} ]ďTx7-يd*J -IPm'QXl9KEL<.e S,g8ʾ3IjhVR;5_Egat37x2d ƞ~CD IWMι $lGH8"zJċmгwRKi#PR-PT3^PܜW4h"٠O@-Fdy_9hc~)[yҞlѮ#ߴA=C򻊼#9xx]v{dnoz=dV0} bVՙ WVe: M> ݳG;V5ZTo(GLgjR\|JQ[L?eD-$LhT3+Dhw-H'^HT$3dWMc_I.]2]xғ;hUhKFz\:Ǭ]a"kb/і^HC;&4R;08dcմ2\:k \Ҷza^hXŝ!q KK-<`wڄl Hx;xUս>=t` 8eDa&Tq{6JY<9Zbu=i^N1*ԓW-@bQ4.X+@c/ D\xOb=`ѝ(GxGf}hU"~Xݽq1|; \ qJ{vbN]C "EC,AHs輧;-I!XM&'7ԵeKXoXhJTǤIYDg# }L: djM;?A9uԆAA塅yyM* qRǂ ?"u8:87:E$>~K&KdDp)% RrDqclqKK-I=L&D|Dqr|/UYdY4. zwxQ\\, ;m'JV^ \SU=rJwG V_dR>+V< @`Eq*ŝ|0:f~?WZlYToh> 99?lڨEYN(m{ –nM[tP+(1;H!nRcN~9B '8t)x Դy'ۧJ 4vp.bFܸRRJ[&' y!/T=C%bRC!GdW=j14F{f2[MBS/#Lb€'RWlQҥ<'7ieIxMAi }mjIEQWhpߙfÿB=_ s`ʦ Y&CS9q.q \ ?H:}lۣ+opjy+8eјJ4EAoƒEYAhl.c]W `ً@"b,gN)l;h kKHچNV#5 { d!?و?F40Eu7:W|*@0gH)nJb L ꗑN bj28毀5dpXrI&NT.u !9Ǔz>ZL8%_6XUEn o5>I&r}/\B45r**çzlmG."}uڜjl$!lB=&l98ݏlUDum!UW& >|K3YK)R5_XvA8@*^6?- Z{OjWhu ͵Gvw)%2GSo.4,O'և#*A.zaI%>.SdyzzT.yO j lz`Lc"'@rS vY(!՗Pr+rzk)+nn] o J񰹸R{tR_Qy_g -[S3s޸ =퓢Teɕ|>Oi\GX>c)2F5'mڊRkL`GV&9>Sy5ݣHQSpn`av|Z\`7%9[ο~S޹PXlFɫ21ժ"B"1H5%w&-p; k[pa+)>QQcWA{n2(H@ZٲZEz8b*zGWg~&XK K/f XwE,g/l-㵺wF=A] ޯz(&%B;"X ]ȼbe]{P(ILC,eƚ.`ryH6Dd4f1-?!' w˜7 HQZ }M=s&$wώ]U^u==üȨ_I̋(.t/"n`33hM.ǤnC)iĈgS žn9>-A{) JRdJD /%mrW7E@xے. xH (3*#({n5_Кvz[>=`3ѵ6vzRR Lpϣ_ <?hP[/ѥ'T|[m~CZn\ԖhpsD&T}ܢb9%pJLi&v'zR+qW5Ffdd9ZEH)`<* mZYfZ`[zǖ.6uK'AfLlo9ǃsR܁)j+4EN@T9HyYUjYau&g@%(?+Kc֦~YhE%2guPapl隀h]" fesh.ĉɔ82 kx"|Hm<蝋Vq$x\dzHBO~Q L~ x 5!!$Gr뾦 W=RF8~R>ؤAgFOμƓmiAn#1_/&:; " tJPpov)R yPg"@&E"pG9Vd&Ms{ <0@M e[_[-8Z2>|/"* @c!8fVL+<*Vn"H@MrZViCL,'pox3m#x[KW;h) ;$Q 8r?# j!>B45V 77Uw xnٖu[SBn 8l4Rd<y(+q-`uU2{1_Wh _Nco72mP|ZqIŻBmsc8 )wxS!+Ta ᑮ#0=Z L[W_(2KD%ϛ!@'ʷcZFLֿIL}hֲ>j(6˰ 5PBdkڝP% [MD@o3 8vJ3O&z0V`k3F&nR88_3<1|-ѷcجSC[sJO5ֵ;) `oԜ%F.ZfY&Qʚ+6HD^ba]cZ{ WHMVl՞#^6ŎMx.gw3$ dMuiF6>}=4 sxꐿk'1(%k`25@!aE+2Tmd̵" v8c9=@ʦ%rSld\'1/_!Jyv";_%v>u`1ïHC^*;yvw1,scM*C$$/Ԡ !*1Љf2=7h1mXc|u|wԼ-Ll-ZL&OˁLVPQP|# Ƽ<5/`ўjzi{ng5_ `w5 ʯ*F3è =}~҇¬DtԽw" g)j=Y%=Q9x] 2['& LT)1'#Cn Δ9"^ؑn{A ODXqu AH.h!͇GJֆ4;N';/gN~~^iku+ PЭ #_q+f$ʍԂI)& |Hنŕ=ѶҔ%O&kp YjI(QS1vձn(l"s]اǙ> kJS/U>)R(56lS;iӷynxێ_G/M.SMZoqiVD AΒ,ּm,! Ǎ\!:6@ _nj.CLRA|y )5r _$<_ v41oR^|*w۠k5-W, 4ʜ\J)*!3x)ADZcF\捾֑q|(#QiU~Q^*F)"z |4`ꗨbiXWzsZdLLIXu'ngpE}8MJ>Rܔ{sʒIk]UzLW 8sK*s[ D6͔M^#gi%Pd簒F?V%{ ?3DbKwW!ת0+w},MX#9I4 ;D+C\T!&A_jBI{9 #{^#3Dp{3W~\BdiqhuGp*q!j9tLN8N>9S*_&פc8M\厰^70kLsAs]k 5 Jd(񽾲!kK̜~Q+X0i1PBcԴL )`4^@9?v4`i*.N۟=\Ǝq(U-cNnq\!&p07iP?a8< (NK+vN$˭R ukB[83]Wln]:u!zBL?dę.,w$bV-9 88 M7\ؑi4g¾f-VYۭ$ɸPLeF :\o2+,k,;e$!f_''H+9)Qb&1^8Fvg^D(jFOd T?l,!]OD9x*V'@HۉFiwk`<)6{*^ާRusٌPwCpʊG7G}bY4,?m3Zq:atT;{)'b'0}GrOi_+]߅xNyxb9m:L_$GCߧz CF!O'/~iX&7LX+Gs1#S[`j:.ahOFNT3R u]1E3䩤ws2I Pn;2Xϵ*ώ^@\OB(]rRT rR&ّV(߁"dLzQPlߎTߪʶ0 YYxjq(;9%էgAJ{LL*K V@9&(MeE&) j!&R`iw!-5-,ЃHֽQVܹVW#KJZfArUU,yCPFj([Xk[_l)$Fyqg4PbaFI[UɕyrW!jM@d jv6$ԩ3T! (egO<)BlG. =cOEN„406 aCe\.!c 0@LN X,"Y0Y*d1n㽰K%tuI YX\+\AEI>{Sd1M9='9RD)  -O -`0 E g98Y]y%:= ՜b\3Tm)FPFr@& [jѦw,Kc#)XNTA L-Klƣl@E":3 cPe97"DҸLVEaZ1`ldKhwB9B+@JID G.`\C \zDJT%V!W-5rIn8B0fļ庉'\7 gs$֩Crl dْ*2D] #wJ<.A90# OMcJ.m1Q|!$ .UQX g()37Fcw$aÛq!!bܿhbKVi! tMG)3÷^QE\}Lfy!(:"x֛{פ>K(;?Rw5ni3{\lɓkVV7]q}<}>f׭hUj!$A|%)S"7:j]u^ߩ08})'?Щ q^7 o˂!3W:0r5g* q*UHVy1;!۴:w[G[|Xϩ.KWs`J_ &Ji_WkG|dOyiJh{ ZVlAA'Z+%BYo?Ŵ؞QpU&!jFੀa: D\LĈ*ÿmvM46]^>Z$c~>qI @%σv&{ȀRi K[ާ\C2 tm''r  aczʥS]eL)7~r\ϥ |Uk/?J- 36K5;WA #^g{VF?7'Q}[,6 3[ yY=`̆Ӕ+n J>o7}9ZIl﹇ϛ9 >ih{R>=0>y6ǘ:|;;_x{cϋ܋ee^7&!ģs(uJ&GK$fA]5.w̱ѴAo mܶtyE % _E꯺ji˒FI5X',x/Sρ#@YӻpO ܺ-Tx0sDXW$f|%]ړ$hM -Ȕ,EZ54;6 a_%@0x"z%usvqfᓁŐXiP-1^ p? )=>VL~&p񘈫}D {t2.'U:ly >bk%SGėS~]r=yB6dxλ`+nkB{ԙ"2tzkQ(KJ "yH4@zbm7]DZ> '>&&.ۭKy,&2$ i+uLP  ~q׏%[dǧ,#M"LJ?Z_dK;[8AJ`mC"(O*rv4 /u 2P;J=5⾌L8S $\&;:&Baj֤̆DWߛoM sv *:auL|8Rb.0;0Kj3ཌྷSs׆jl,'9K@[Ob/$ϒq?oY~ %@5=4δjbtggG2b<wrDy!.i 1c.3M<-3Ղ+-1O5۔'-)b:)0JBNJOި%n\@!cL6gVs7|#NzXN|Ś:KtPAHF2^Rh6Ae}LF?B8B5y &](,:gMڐ4|pdu'Ĭ ØVwc&)ﰻT5ƯAa^Pn:uE'uމlѧf5zgv$LT.E7U{tڔ'^6>%50S\5Cq>?8S౻.< F>#K3tvfo,FYF9*#r$69e| ۑ#I0 d;ϯouӵfmMާnAILrolm\%@6& "Q> GFViOyUdӭ8.-ݫFv+Ym6WpQj}:~J ʪCf6 >chU P<#Tl}l€܌ML""THh 9Mi >v@hs$9/~UKvwThRzb߁*hw}n 1r-TqDC3rw $ F۞2¡ ?h\YRsIY} 6 \qǖ ¢`9T*pZEa &m?2t҉<9s`IDCJTZP1g3KX|`>cox"(r mqZzwens#" :"3$ )8ly rRCZyhr!ZN.{j&ck/aN62u9f3?!L;h 9yBX@$J\㠍PXDDٙ|2Ȏ7U1 {^_R48oxn^( +1w%zvz_Kht99Q^n0E) vFnpt>z~:&ɐ6u mqvfE(PMu5HU9A29flc~ *@a/$ 4DX^V99GwL;p,O(W(%ΆS(%NJWowg?lxKԦu?[gil -T&Tfw3f',jhq :vl aऔhVWZ%'9J$y ^|Gȥ#6TR{UÅ/4Fɲts&B(t&qK'U`[E==&Oo7yyU{Tc3 Si[1h+ z?9eF1a3"G,tlOL1%&[7e}Eq>tOF]g[KmE!;ZE Rdӷ}Ͳjz9o%_lVw/6x{(F1ֻG(dV) #4<+A5G%ͮ UNZ,3 lEtvSbvyg\bh?kPUo9#V7)u&Yϑm` Mo]PQ-udk1kE=*f;Jw ?fwP0nNiLT쁗K84i.]s'8M=Ə8FShhV'y_EB;Ux%;SV]巻#Q%D c^ss8uӺa`mTȢŒ p~(0@}D-MP4B \$֥0aw7*FBgkA cy T(;ZPgţ[e(0&5/S9{K2H 8׾W> 6juȁ+*ψSv^Ҋ3sth9|:,z)di J+vhF59M.VCB]ZOPs|sU3c ZY\ܢɳ%5{qz͹jQ XW(Yf.A- ipM:4 c@$xD &<$Jh8"1T؎P8]!~"gbUKFakNzX[.LG2Y@'V;sN| cضlqY;l:w* 4{ \(:VF6RTmEl>"w<|yքWF]5픥mxo=~e58czɁ)3|_եyC;48ȟQ}eUQ9E@I{0H-tz>ϳr'Q[+>g'WȀH@͟r\3]!5VgLN-cy|6m}s IP!o__rsr h4^弛75Og=wi$6 /78[,?oӫի,e?^ʷI\ǵpu,{:9k,-Y z^cqk[FfyHXvx2_S)R6.K{gc;}ݑ k7ZJف5cF@6 @!Bq F E1~oI%L 睁h@J%\/]pu8ц"FVZqRyh嫻$ 1WdXГv[Y&Q2c6Tk_ ̔c ?9RD}X(L ]"K DށQ0ÅWc,$#!3KQMMCj'p%G+cZ 垼JpҴNrx#7V[eѯ> ј,DpyDebNB(}O_`ʰ?gr|OSj7\Ǔm4o/r7U 6'3OȘ|}Csp-dM?jۜ]#5*4wy=bA.s4pvP#aF|:sf[ԔeͧXMQxcQ Sҍl ;w )3wh6~A܇NG`}XoF }tOLKOMz"}Jϻoҍ׹G$%;}ٜ9+un { ectxpQ4j#"ú'7ko{99xr=W]~)ůg4@7%1f^z]Nl0G? ~ݤOE<\ӡNUHavǐ Sx&m:qP "܃CcGi7w;MxtL4G>a~.W;Q D4iU]k yNw"o=]쀖 Br1(f5|n̍27(T2CN.RDW)׻Itׁ~ǟ%8T2 3cy;cM!j3aӱBRXaU\ p .·6.t+ydh9; ݭ T)&0=%CHh%]I 9 wv 4((b`K 4MS6ӨQXgUQFix?rGhx'YV9j/cK;]I7h;ni'85Ot"p$־esj1 #dxoƥU0fXP.k=?N݀Y;TР 8h|t͚I3̀4'!! s1)){ܨtN3`ߝm䪄ꚏmޛ1ӷu;wRBmwɈ|ujap$@ @c"sOrAu *Ysg}I<@r78L2΁pKTs*^Ӫ6<5)UJ~i%rሙ}C\aj& $0"Ѭ!f" 0@Ɂ$xN0Ԙ2p[MMFvnCq]ͳ`Ynl#"MT$b!_!SC(DbbF .@U;Rg H\<7|?z8%lĆRL(_JQrE#$$$RsD$o8f-ּW`Fڑp坼IA+ڹV 6\K/ @o]IH˝NGMDrRIn<.-q  8:B$2{P1TRGYIMbAGA1ݗTJa}7+6]lXxx*<$۞&TWz\~$NT7,Q&d-l7f\/7M90=HqP@hUuu̓FS9*F\GGu,t)M&XhP~G86@X(AemF!?$HR>IPK! ĞPŌ%K }Ci 2#G{2wCwIΈ@q {:ZYܯ ;t=`l/Z֞abW4BcdAܣ *V/sOK׬vLL l%v65RUpkƒ'~ahXvcΖp.5{#(I󯴚/$82Z5I߻E0R;6b =z/9O]aht3d~ޢ{SuIQt]a|'۹|;cz|k *] -*9M\Fq@ }dqA+oB-Nxz{%:--]6]\=O?/u鯒7 DztD<L%B&n[~Wm̌BF/H_MKE|()ؽoѧ7HK~5-skT/(-W lMq̓yC:E5ڵ{(n)$0  H:Vg~4;(̲G_%o6_~*܈net8ݗ2I/1 l#Y caLK 1~O_J{"5j gfdho%e# B<@tN1a3*1U\3tԒUd tѲ*vqۜO*nB!%͋)rd5[ٵ.ۭ;vEepn\W>A;|5<ۦ>T>U?Ywg|.1DL=w5 ҽtϑt N1 Ñv#+DuHлY>qaZSc \4YHQc@0ǡ2>#C Vk`U+/)M}:VpkUTQ,C3NG͹KF\qB;yb-.$ϖa[׊m=T9wg׶4v~fh( |Zp_Ҩئzt+9֣qN A՞~>:(׎_.d3|ϹDJkG$t$IT( /j mίo k"IVj`,A9Vh (b2 +bm}BCu- 37 mÕ -v0PkiAGuw(Luc]f+{;'}`Zi0sX;9 _Ur]|̋Ѭ @b>d#SP;R{k{f8Wq'~=q [Um?W4.2KߌғB3'ڽe QdWma@ hvh;5Zb=1CG;#h_Ƀ'`3վcU?uDŒc]gn~뗪XSԨ1DͣFƬ@ N>P O(|SʲyD%VkCo+^{%*;)tlU6JB4^@9-z}|Fb]wLS7ONQWpGQa:l =;<"v2հe2i)Rc5N`r ;s,]i@*#U 0pbE<|Uhu1gוxFj*  =+tW^g)&XTt{ˆԚF^ZODN>n;hYOF:B)V(}(OSuV[Mz'3Zz(vygHn]MԟK82]ӇtF|,NBsok}MZ41$ ~a] E cp/BkUe^xA6~K.Nr"T*q$jfz sG5G'͔O‰K-Y|@ֳW7Y K GhmՙI5k\KcCr 0w_ׯX14M p%XƝ<[~tZN?5}[1!߼iIN%sDEpƿԞԣ+kEМ_a&J8&nхKWȅб,W+Se/*MXw20jųfGkX!wñI00g% HtX<^0) .lm@z"eA vo^7(T=0&e9s28UkR`Lb,LPG-3-5iCdɕ^38Si60bH g2fn,U $w|1ijݔ≂jVhsJ& we"C%FH1䅲;wC^YX ,TU ŵ* eϕjw CIm Lp-Q"061W6]*qהI;er?%kWSSgjZoL l^cn8G>4aBA,Fu㰀BkVk N֙vP@HX93كFե.jMխ`'õS>qAeFkM >ﮖZ͚A boA;]eJ͢|hn⫉VuRUvY4n%d̔b鹣]{9="0үCf4ra3cΛ)CO!E {[2n̨zNv́@c)0Vԋ'Dt@!tAWd+D |ꘇȅ еvdK>V/3 =ٺIOhuXm4 uhi!{y? y<$y6r㶼"dR2YF)y2upHѷN샗.fyq+Z4iҳJjᣪ!!O-kįuCzunKg zI3DL3(F<* JcB/p`1N%x=hGBd6SR'xQxU^4y@ A>όL /-]ggW96ŸW1 M3¥2kN'UFٕyyU#Jzxe0U+Pcr E ~8S2;dUohe bC3?H:#*TbkplI;,`:4o558 3<;L{ ~0Wݔe˴|8]֫7g4:,D"|[ NiB͝3')n*{#gI X{qN qU衷6z6Pz]A;sk'{< Ӫll%k͋3`˂i{4T[z dTQݺZӅ2X5Tv qAmZ.& ЏB(X^Ȁćƿ֩!Z'&d-R,.]pB 7Hb MckhB]VLDTb^ ٔ`x0[pFcZ6T 2\~Iw!D]9hWY(0Mee^~'4t ;qcBg8!cƮ2v܄*KWZ]hQ1ţ2t9@."^(}*~',[Cy |8.oO+C0\yshlX*<%ajq0|H[Ky: u2(;tcReA\j!́ؒuJTvhteyZ>|>5>Ji|F = 1GalGz_  ^n͋ 50c34F-DÏCCPC[j] _v9kl (7NiޓZcs训Rv[AH -%y^ ʗ+t?2|&|uΧrE;AAmGh!/T19_DLk}r]Tzp XՍS꺰>64v#)x\?]ϖLr;;3g3ҥD&Kl,/ǩ[ŵR&^ %TX0"2v7679"`,? w1:MŨ fѤȒs2!D hMf.18`ד)`P~ l ;k!+/vMI7 8T= rZr4cuv}u UDPJ;ԋd˵A$D7o_D/͔캸l#m;/U~w©lf짮B{*>\pآ!`A4O1]!Rb|F7YkdoLP~H 66Ñp<E=!\lA15Ct, 5O2?!9Wg)(3 BaZ1kD]ع] ٰT/t*hCG&HBH%? ;;b٠3kLI#JsA0#sp,mVہSI{&nAƖ0vko(>CJ7l֗(m6z;SmlN(k`o~9n;{MN*|ꆏJ :S1$CnSVUP(9nz9f 5=n12I(ɇ3@ -%(p˵"nw3=NP]P㛡lo?&Ҭ*̓{D"O}{-F4mګaBxtvQ5̆7|cei1u<|qe.ǜ\cgŽ 18N?⪻rcBx<պx1|[?ZwGHhbbG0)L5ia{_tKs' QYAيC?#WΪnML"=,(';? #À+8)Q9؆jLWYu 1 1P!A }}"Obo%<x-?{sOh`z8M+H/t9Q_J3+rx~H\ڶ7󿟮Fov6"A̅`)ckd^ (1oQxwЫ߆i۲J 2VpكR| k#.ln¡dQJ8KW.rYcnʸ0ZZpo! t؁CkeӃla4c%F-qK=LоRIjYpO'y. |DŽnQCu/'t"[0Wǂv|:Kvb:ϙv;X W:h8PҌE|ԯ}296 jC{ 7VMy!5X[4;w_HAE ut5W>jE Nh~1V4尴 DYWmnlݬd2@~$ jɉ9L˄mXv/ ۹4؟Q(b }vG[Q,OD 1~"@q5 N Ayy.: >UC-8ѯ?:eBwMzŠףnb#9av"n3_pkcׯ(%Fl況jy' pS&t2*@ $`TByӎ쫊M]pHO`u-%~]j[2؅@Ffln-jMW"Gڂڑ%,d 2yOȿETԼi4>MpYеe[Rtr|.Fm_T^s7MCj{`+x] [AHf=7pƕg^E5Qd\_ ZG}?x\\3b (iDR500nHI6mnhn攪 Ox'9ZDt Y* zjG9ROGg #$_aLFWb5pLšPs4_kCQFYbQ}Wn[X)YBB%}%,gjˆ  B IE*}piCm4i|C Q|vtnpB!4~2>ϨI *_ɗa:1 A_. l-Vkݟj;6"d"{KfS!`7A0˂8`ח%}/2Ba| >{7@'$1z7lQj?˂w"oC{}D'ER6=‡ \3%xL{]q/̲)qp-.=? {/)u@ )uiw{Cߦ!„0Μtz/ :ဘO pt}LuM438SIh^@VZ|sU , 쉷Oڭ;ދKS%3X +'>W(_G^,FrpkAV`F]6bHڰ&Jxv|_Ly`?8hbnXGwj[I &4E(d7ב>AAQj  R˒}&i7d%`s؜ïdFRA޾X~ͬ-v2v^K5oTҬ e@iqُbejնcFK)^Rޮ(23+Lî]F諴z;*%) Gc:y2R &,Ͳ+b.r&W۩ZB ;li-b|ީEw߯J!5 fxIrxioegx(Qd)"e1dQ'*_5iBH$ <| "k %a yYsuJfhgkF%':mE4z~ /۩lRb㝤Y`j/whmlsC3ǵi+[]i }A mJU.B&R#5)RYlo#r63FHɧ*+]` ܽ4tolSK,h)!GKw:J?%Eø5ψn+r\]%=J3k Co44(۵ LpTFgXDMY]FmQ:^)4 z3RzH1n"׹BTi mF@" `u褉-n6.?YvN7!R.E.cyzϠNi8~sKH_v/VvOّC}-@`­&{5@Sz!?\(YԹLp@=T 9B1 ^ٵJҡwf;i;^6a}hܧZeū)ZR$f;3CmMmo9q/C=e ˗"uAh 2$P`i|Ĩ\: z&IL| /{n~M0rB#!ܡ>l#hR4?ڮSu#Xvd!ABi"̦LљڿF֭vk(v,ا!y:vU657ERL!d5^lʐב2*u#@|Sz޾jg?Bƺ-C~Q&` ۉ!eZlpA3`zĐ _fi6/D8A04.*$I!JOhg4ުi11AܶG< A;ƃ[uޢb6Hڏ[f1c $JHeOz1s`???)G płu6)Q.^E&.9^ io~ .bNd\vV!\ǛDEiw9>4aVr@2$=٩wp > %޵m~w'gBǺ5P.IJCt18RKu}&Xo-ֆv  s ȘlHA7ۍQ$ͯ;UsK$@MWEN>'\p)+zH?Z3 Aj|"Ғw/P8V.f^Q"j٬I; ZWv#iԭ[䀘j@dž$LQ!5pEN\;a3n+-b1VX͆Hip-zHYo@,2VbR>P@,]_/CV v.պ%< hr 5_.`9nտF^w3 x5x5NP&bbL5z#Of҃L3vnms rOxKNF%$|g#jXEG0"uYQ5Zsps3[|)sQֹ,G5MU4CIgdׁDJ8'{[pF~β!W[=T(V2br%SFPR1 | J%W3db՝5=ZY~ciF1օyvX,qP}k,4+LB49ˀ-9"wg>"M9x݄jԔB ]'1COY cNb1>#1(8R2)xWY!􆝵b8.˦kE/ޖ̹ݻ^ J PK4;V>ёz?0"k]I,6"gx+i-WK|h-MXHY`x˷?/qi85$f &wORʹZq؆ ,;AGՠl;4m /u $fjTǻO?dy7AҰj!؅Cv=}.?n !. P XIڗ}Z9R'ŒwNL- Rwǧ#,s՛D0t㙨KJuB~GH@`5B cGS lĪ5G*ӻ˩כ *%+Q L@!Ӏ[QZ/؟2VORvhf܊OX):$ YmUZNLCnl9^㎆yHiuӕ $ WMsPH@ Y^.Zcjr9,Zl K( -PQ=W L<2SiC&FeOҜ=y̼j3S0vTM[z$PZukَsF oE ֓/:dL˯б,w8y-k|9L{ʓhڠ)SzwO㤅 (.{NˢsƁ51,$ JLW }~ `2]B w]#RN~R%+A`b6g엠֦BKgT+RJStUv T<9ve5ޡ֓}mQ]{ 0Zd'1*Xqq1ɡ.)ERJL?oQrq$(Jyn*:8(a{̛e7 e}W<8Y;roeLA&rwGImItW:#h*vWȊ4 wňڴtSTנ鷪גQ9-YE eLů!&UXo&ѽ”\U>D)Cf6 ҥ 9'.YAu>Wo 3sѫ" IYlޕA-'xnQqs> o3]>e˳>eSO$r.e@7bχ+%LSݛm> #@+pm@:y0 s6QaB:ҳ'zE) FC#P~ηK^lR6 @ݮ-΀0,'cS5Er7]mwrQ;\W6eL#NA , :dqiؖXtB RXaaM_@!0!>ᚎ,&P+ejpi6mhQ)1)w/[Y` 6D_;o /MԦ9v w{aY=BXP~)'65 PYxmf-(&58h-MūЇ#Ut̳rP.XRVܥ|hNjg>Uf-'Y6c:@qP}/[U^ε$\bHv K7\$~/k=CD{QAڎ\A9p(E鋞,,Ho֑v-* To%2oLuw_EpR^,UD(ay&Pab}[%N]Ӣ:ȝqIfմk%hFSTҴ]9Eƥ$p X!l:2 7(2,2:]h9se3K&DVQmܳٷ2SK~?hnHLjZ'{elt*Fk|P'"JRaʅ!g/k\nĪ (3mE<%ZE&]B]/`@`KA)K3\Dr=wդrIy+aLjXYEpfdsЪ{Wn=.t)^wV{E\VI;ZI!icZ )w>f2w=18N-28谤7 m͠: ~3+bD 6L"jڨ^QJ.7[|_5Da? @0ŻFb1w8sI:g9D_ZW|6?BnWx$BcUD?W72\kGO"2u2_(CKU}͔(=0SF3>,2uY:DDrUp);GlgR5uå:5h?-(4W/ J$6[;l棟ܰt5\ʲB s%}HVd(n%(_fI}%V*Vn4Sk5ZBDyE ;U·^xΜe}՝Ҝoʦ;O68+?Q$Ld4& w㾞~Ǣg2c}ᮍ9б\Bq܎ ڸi޼x]dgL*RtIKhdz{xx ,ibj7 j̝LWn[!i8VtRWR݂*]zqNV}kZ|zQBsDGH+U1{ ٵ^SMFąPBTkHJ0*) (MhDaŲaRʳg uהN\%>o@ftmѹstU96lF<؋ȁj6`%@[K<3)T)  `ʹ m{޾i&n 9~C[:*!QەJl燱98u `V<ɺf.$ V 4/4WR؆eZQـ l DvÎOY'NLpd%Х퐠uZM2k^}?b_nܟ߼ds w0[XӿA\1V8RbT8$ | #u}Ft]VʭD^ni>Y+̞1_q,$[]h&i4jǩHֻkM MCs´\玝4k2M[|Y·%*q$*LWt+gTuģ>~{(Ŋ; V k>|78f"Usk ҂ƵfN1i 3lq3 0‚eylo.3q"궵v'H-3"T}WjD2WP nc նZ_k`NX8.8IS4ks$6#&hZCz/eU޳h?Bm(;'>̹jpAPl쿰ȖY )ŝЀ;1R.?KƓjk&!;֌tw¹Ƚ@(p9pGj-|V<3 t~=tgf,M L@*-&KPݫYn( ٖmzb^LWXWz&h4O/&z%{UӜ!.j K+`N!un9`*{V_χFfͧW>SVjzո=.{9eԆAB^jtC<P"zKbb c60{H(rnXrt8pe$, .mruu)j(FUW/LuK嫋kmۆ<g:d+tZUVfUDҋVݓtɇ=7tᇺ?8S=zFX3]Ņ0q6|$${G A8!z:BҬv g#~hl瘉:\odScbZ[o=%MlW=舜$ɽXZ.|P [lrwW񕦝j!FJ[Dzt==8YSܶ ~'O>h9،:Q`!g'9фh Y\{J<mm7 .wz/u4Q[a*c ?-`'P\/nnχ&cpY52:FDjkEdka(ez=FuOg.LîbWBNJ:,A1 SW 2"Uq>ʙ%p1~&=e'F;LBCۥ=DŽu2/Fxmf";-Ѳ ynOr {ϩbjzѶ9mqs)ųYe BN}:҄mO- EHFYw8oXY0ǹ6?vv8KԶI}QM#%mcf##њqE+M,j9IHk9HgkK{1z+Qx#92LJSfēs_>C"kޡKRۺdiݧGg lv޾ /nE=Y9ϓoD>`DsQRLz|Mf&#|WZЯ Ms`nZ1UX"$T HaQm;wݍ|Nw 6kk:P=4 ե粸Su(sZDilʲ!:,reNDF uGt^HdR3!K>d S B__TyHDžXJ6I٪gJ3K^uXX""͵#[R^⌸,(bג5ΦCdLy64Js T Ň^c[kYo5Yֻ]Zکj,cLE e8!cӓ!y̛f-rukPX_MX!E(5"C$IXp_ؚ5w_cb)W nYD}$/GN"R2Nq`{* t oӃ '2{5i&$+._zl05=&2sU~FtjMYnKB$.UZE׃@2t Ya|Tg_+wE}܏A2F+7fAF>-@"SKZe4P>Ԏ4դuWh#QT6(Q,Mu eG\ndaڕbL7J6٣1=ܧlkYקM}+ݠIyMى= _h/hv8U=},]m1[|Е\ ۿ`۴łpx$DYӶєQ"ݴ몑)pber$\#U7V-H4;bXP!l*~EMLz),'&kdӭ 5gVzp?&XRFxfq-?mqŨ?bNSA7ȞZ F55& :4'3K<-Ǚ`fQw 1-F[VA Pb\ɖfPc{oBA8$'q{;jDʰ[iͪpch۝|L saVg7b.HBnF Xj,F&.-QryblQiTp3%Sv+5x$_6-ȇ'5i+ s;Q$੬ەғms K^Fʈ̻jFR݌yQB N^VF/6|jmcnDe ]嚌ԫLlp˶j9ümȶ I{TiׄsΘ]&h&$_Ub{uh)+YR0-x]#CI>vqWћ G|S[ \j9V/f8b뾂i= sgq G%5qH⳥Y,YEplE=gۗ/Ho3a Įu 0jhZ zu|t0t9~Cn-? ӧe{ m5ִ.ްcYЃ-Z VCwcn)@u8oa~Fd0Ȓw];>y|xP=%Vsegސaٯqqj>Y_ Eu m,ya\sFËY*=4ұ}c aGʚOΉJ=ز3=PxxSFaё` w,MFdŘ3`K"GvMtQJC.̍CgVB@ڡM"Keg /V`U]Ћq'2dwFF:etH%=HW51P(Uض+/9#5IۂB'acg_ZS/FN,f::GO|U.WOG54Z_.A84tbShAȧ5\dFmeEvzcI]usŐ Hӏ251dXfF PaN1ClX]@k!#˘{dVJ-$ܑ=&h+:La|ey NOKuVlgg{snw5 }f;7imڇCᣜ# كcő@AL EL%fUiq9Àq"=+C=yn1sYmn@!ז<.ؼyhUm(N Tm&m$5/U"| /8@e79wrCN uKB4Bz`t6p┅~)9@L-;8a,$X^f =`4(M~&8Kb@ ѫ"m .S[?]r XQ x]~N8Uϱ ԡ6@ چv&&Nkɗf^@"vLsIvȢlڙ *C@}P*vf|UUMnqz};[<6|C2>"?M#!VϏZ} a_\ Ŕmo&@[@p{/qk(dzR{^~vtO_ DP/AKF"&tQ,v< _2,]OTQn(!G& p0Raj1C"[ T2H͡LY޺gaڮo{˓KQo{hg]J:=缠@ͻ;W@V&Z#s_ngsG񵊢E0@Sm˖{MdC:rN23~%<ę9Vw2cėÜ75tq"!"%3(% ^/ Mhؗ4|-YFCsikd'uw;gwblnۿb> Nrr2 &=ݩ=N8\9? v/Y.4ˤ.Osu:Mn;6V̹<Β€B+S7jӰ+BKO ~a];gU[ZP$B&888JV5Jxo\T41u qb,,+^NW}X@%  @`|E.DɺcUD,T.LnVvp*"": +\(NOϷI]Nz riwLo# c/s* ~eDEMPո\ P-VT3rgn;f! 8>>Վn>m5JO,p?yQA@(@*)2,E:|orubYcKDP]+r(\,@Dc%j࠵),(3%oX&~P!`qzq CGPĂȈ`PMrKT[ QP>(HDCoY@Oz!Bm"[k7QvAIQ0zJnȀ\/CH1shjFpɨ ڈ >zT%j_*`"}Iez EnEx(u-UD"6 Zys+q*U!ܷWh8^xl6I x`}6ķz/ ?z\18.N` `E; Dɀ W.GyM!b!DUqvA IE AP €  ꀆ<@*7x]Qw beNF"h(X3Ey'a\M (=g@_]$D L iw 4QgV}_qw&6禿sۄ1>բ4b+փQMg-CsPpN;y<}: h"8 u܎Px{>Un҂C|!m7js?: N;~EZ* !kh.(!vֳsy0s[kؽ{͓/OSLf6{;<8zΈQ`` ^L6g#2a1Qg<=k<+4SȻCnzŔÂs WKu1_N{\A}zBE S~OίCyfRR,'!fƓ9Ι d'4rήSƒN#2?| K,NRjiM* "Oe`p:I\50P4 _OO@Э4r pP ?ap;" h@aaN3Q_U;Au&Jra <֣ N|j̆63W~6C`a z 0 ؐIE & "hL+;1V;iDLxHH 0;0Zn{/@;#t&׮?Ogk^sVKm59:r!`޵; kiNn +JS^~o;ij4IU}mIKP9vGa <5j9c[jlJG6]5HWqlJAewWNkm O  Icu(HmDyi | @ow?/+yua.ǴmUAT<Q~w8P ݌ԇC=PO./UB/c, Q)9BW&BR Y RK*%"[fdB( ,? ''pR3 פ!?,E*Zq6!ц~)-t2T/WkOL=_iR\>,E )TL4@W55kТ\*Ay1| /Pxv1 *{iA؂0"+6Uab[؂ĻeVd iIQD,Ur J(A_ʰJ!lR?"[6^A=PPatIs]% vꨝMZh>5;YAuÆ52jȏUi~'0-~o@9ƭsk'Kv&(<ѿ$>3@_ ^h Um i >(MyȈ4C (=$:XdMƂ Q+E͂1@T>UqEb (R((8XN;L) 44UED2j>,A8.1!tYך| bwp.*_aCiS*EA:X@tQP3" `nvEA \('ł(̊'@A 4T A (DܢPpz""4E"(E$2 kல ΀#~݈ ! "(lPQ(FFVd}ڜ[, !Ƈ6Nk+Yu4C2&%S^ڋo"D@ "U1#z*rDnˁAc6+Ҁi(rZ*H<,E_E@L ? qPLj) vD7slҚKT2"H( @"૮YTHHu~jB'! &[ ޢ5b'&<.A DDkD.0DJ2'e*+ a:b8qAow8 "? Dm,B0~R; QzdAK=DO^"&&tsQ; XT؊P\x!dP}dƚH=LƿT|*Թ]-3ۃMIF4ӫ掎lsYr-/; $/Cxp*@U栠8AP""6@QpDEO倡lIP >%rl(˙V)L)T황vua zeG/C~*>lPAN D(x \* $*XAU1AELx(VA4pkŅ_uDdNEQs %H%@Ay倫&\`gMS|9]?1@l d@ "/f LT(*1"zpScDpLZ+UWw,i[D_Ml<סKTES6g T(=4 TWwH)4V(fsћ@Ȟm4u^֛oPˊELn͊7 Xd[N,k^[Plk)U309(YŠ ފI#C! 7~\ޣ&ttSYmb{ s(h r 'ox*.\b(!{"|Ȁt@DL =@ \ TEny5P*o1};. vD] y1S 65qbq4 ?3QA4b)za5pWq ˦t;8mAt}8:(>,+DyH:  ܽ|Ĺy"*dTTT 'Њ~">S蠟6b^C42#ǧꢨmD/3<;TĀ/z."}8ȟ!ZvPz+tQ:8;g"y@4D"*ev_>JUt>q͹846dW!)v=&P_wǑx@)S#+s`(zwqN{X?+3}q೒P;Wh}IwWa:қGԯU" ] ;u5:Nk?CK:Ŋрu? =/ y4bܚxT!^;7ߓ7xh(/p^'Quv޼8w:i]4?ot(dG>.awm pSy 8>y{inC W}T9x㻟wouDs9;=%?ww}lO;rFQb⁠:N2쀜?>Ƶ5+ϮErf7 _)|U )J޽tqp=oϧ.턡~w60+a|R͡p=*==!fW5`Zfwem뢜~h-Ħ@AA|6|F#<Gu~4PczJT:8}z[,&IaDܷmN23(&E.s0sާa@x D8tL< 6CHtqѨ}p-j _79XRA`j⛯ xa9X՝m쩁b}V]!TZjxqYAtO vnO ``(U!hjLwADh@H5G(('IȂ`@( ~ O[_S/wKY q "͟aMW  N_ׯUEM,%tIpÆ*A!YxԼc3G6sy-T HѺ˅aq0r0TE*~f,B b;IJQt8K`ǎ%&'$C]VnCY=IQ!"׏HhY3v .۾uKi20C#.a@V'g \7 73da|P>51^jGKxs# cHJYg " *_[&YфL@4n櫟z]CGwo=`j=0p4QDOm]jլqp!Aǰ&MtqercfRΩJ NL V8q 0 R V9k̯d4&vGp@0 a]ң S֋,bb® YElX>zDgP bFj-lƘn ddf>F@lYi%8)Hhe=+e `=qy:Bci3A+X&W N! 4Xyz QpK[z"0H[ncXJ*(/T=5O ,X ȆhxټnŮgpkR,}!T=K=S2P!LQL$qxI"`.8 !#m3x&FSV:h&@Qǔd7AdD1:oMb.U࿝FL&qtN#T`d8>MrY8 R+Uo6.H- ! շ֗[N ܚ[SX ~iI |Tbn5Pcb6oh&m//n;/tAEOkv}'6 lhh9tޝ=؉~LVo@Η>apδ4|m6Up=]$_.VY˳鴠:&9SiTu-']a/oeZg|:~ S}oϚګXT80ε[fI?g>'BYl!&bzu!NG5I!Bؠ`2]L*cl->y0tño^Q<^j|8G%o{ceoD?DG<)W룮L_>&%.H+IJvpܸpz$Ki]Ƀ *!B&8Y^dܩps6Z_J{cv|:ᝩɂz YV( %'%uKw5F+l;$߄U̹[X鶀^k)i>_?GG +~7ڊ?Ie}pu߂{Ϸ< Tp2{8.}Ɨ9(z@p q?wwwמGq_;qPyvL!|Sq`j gi)J8 0 c'>htS1Y3UGz$#?kH0 W3M3ټq_Hqy+96_ffk~&9΂WECRD]32 Dݡ:Pul>6;ȧ;yma͜=~]K~@̆QŁA8rXLS TZb*N#"p[EM_CD}=G';@;0+>TbKh w>D]ɂ"PC{4W/=D`Nj([O0?.4"v3)E/`D`hwrѬY"Ѐ8ԢMD46͂ڇ{=G?Nsoʈܠ8[=$jODOM裴`'j5Wl'HwzR"l#Aq5m}Qc_{ to"1^YƁGWD3ItN{8 ^"}^'5c][jp~'8GJ@DĊt/atW@`.}rAq;!D==ECü{غ_^ ˯p5j#;g- yp 7.;Iƣ|zFC6rT`h9mXCW\!@#NZp z%)VEk+z̹BbsJ 9wQޱ*4APf -ؔ.pRv Ŷ'׆'3 X:Dq-MQ7͖&G 'D_x)PxQ@bAxH*\ku$VD$K*)T,QꨪQ'WÃꊡuP^ 40OqdLx"(i M7[yG_]?u_7Y=N{ΈP_z vo}6%I5-XmpS׉yh\W+ihkcBxư}=5~V¾yN~JaG\* 6=LcU͋PFxFyuo/i]bQkDzM~טٿU/r(٢YhhJk}af e ~b  | U +FJK(Чҙ3ܫYdP`z-]_w,S(YARF(T1|",ݏ3z*j1EƢoq/XJD:fnN+gKǑ;T#a8N4'LקM~W?kMYam AwzQvr |uKh%!0aA몤[.2,7iC)w;8[*$}(0l09E57#%gqpf곺%n;)핆WH!=՜L8Lh\ZK)3i @ ~5m3ш3 aH;*}k!33wZgڵ[y\Ѹc~ƌ :G#=: -[@\FɭUϧ).OY=PUz{Q1%j9m=u{}z3pOc\|8s_֭6LXq|c^chu2&LK%+Ikt]Sc>Bβr42)vCZ\u5Ռ, 3ur]яxt+vO@2v!^t;2[1[kE]Pzʦ3瞾|:ͮgҚڸDv,[<۞Ui^w)&Zx]`T&h[͢(<@3,gZCh*9oE-܇\nDefkqFbh,4Eq2h5S"%l* =+?k3YY$-j (yS,1?*mRX6< aq3C>jJ^&J%<kjhh4@fq!mzjh7Wr Il: nA9`Q+ i~erFlF@5T j==s7U 赙Ql,W 3@ [B{ˎ0fLpLQ6X8\ޑD#Y|QYaH`)@1PyP 8 T+hHՇ/i4dXK2"ؐ:/FA=eg>nbApG%^/pS"≅l-X4o`RM]KS3UX!3K R(>RoAM R 0A`0g!)",AK2@>P$6TdY% لUI3l>w  _kS~#+R>B*CA"eW՞{\!@C]YIJQM7OэkHIC4TD di18.V~ߗO!43A.GʏՇuCҝ &&T5Q3 YɗǏZX_,FXnދ3.mMՇS†pHF[y_/OK Hݒ[{Np\Z7MWd7Twڥid|S%28>nnB+E}UFk*^n*|N_{YCk_5w];^G-*t8:hݻ'}pze Ic=I7_ڱ?g =%ƚjk9F'w&SWۓ3-Q7_6L^Cmfm^|mp^>&`A'&Jx5}\;>_xݏI/#\EK E7܈kWikv1o]cxOUqeԖ'_u5E}zfcW\lS|:g|<&:bR󶫹IbFyo>DV/Nͧل1g# vb)":Iz~Rƞ6ї3fդCuLSwv.אָ-vTTo*uO'eg=?[{y'gͼN}Cq70g2>j\S!Ɲ EwE5_{ G9]4Kru[quѧk~WKc=YOuWfMtj[%s8Ҭ<}eg[U&EM,kY:oSV͓6w{aLŮl~7hv;Oi!d|`č>=#UixPRlvDg.w2wvQ5ُC#RY=CNOoocp~c2>lWx\[z3ڮ{~3>\b>K~F@}m[in3WX./"g2I?69hj/>rYͧiv @kEiOeި&'z zk, D8tJdYg'ȹc`!GlC!D}n0jOPṠ_aOGTT5l+И֪+tkKSluOsp\}Uo޽!q^6/pyg,s\@k\>ֳ:= E );F]{{=L쟰gz[C0]/_0}-P(vtY%GVt=hƃP2gz԰MUYjArT1^*nC;Sjm:!/KcEقFb9uyyR?,ne\#MEvYm'9ǵJRɒ?0NC!Op.؄jǦszFf^4_ ԁC&@yv.ΜEc`9D۪ohs.nٗ)pԏ thz(r@yrHJ+Ng9qM?fL6w 35&;txY=yxÒЈVt[2doPُĭPC>;YNdOjoَ"vTf.Mf/zM$roKy~O<ep of묜jp@@. @EGVB.dP}٤<'~+9Kkga1UhȀXVR@ASٮdEWN 5_FY= "[[~=`}(S5"@} TDz cu7fYstv/W <Ů;cka6+Cj#Z3s@FB &rYįy[GܟUNIZ@lo \EkU6+U: Q$ WDfDnn-H)ڣi]( ZA]z hg<$m9,z޻#["F>k4g?"c щ냄qF,<$b2ZH $0̽r[4(q/UVɄ%S ) ĸNDiE$4Rl9ai$ Hfn'~E6?3E b8;T>seΠN=4$ ɹk1W[9UvsQ&dIZq&#vn^[NN% B#J7`1c߇|_b<_JGeӇ(л oNO(ӤFDiR}1[{_ dRx򰦦U2Y71,B{:PuL_g| 7`FKҢJPkΤ]3>UЀR[-+Uq$R7H834CS2E*嵃B\0 :*yOCmz"w(g9bX ؗpUb+kČuӆ43N`89◁p¨b0lQ mޕa5"&;Q &J;D\b'K+=`H"\ a ~ YH`;P m)bsy "R}R'A\y *U2́x`60k{\g 3zDT[8Έ]BLd,6?z5,N"n)!$J3SҦtJc*. w_1wfIKN.r89thf0XF,0MU1P@Qasy( % rj4od i[݅pq<% W"&LZ;8K"BP;!J(K%%0|! )1| 35 Յ-L yv~cCQ2̈} =OlԹ%)y%7;. Me;Aq`9jRP^JF'.(: pa- \@P^/Y^׹m*6,K(#i/В 'ܐ!֌}װ)߫S2˱ŠeF)+ԚB"^ucWvDmNjM6Gf]9t$Egt7Id`MY6&0`/FFȷiM&/}ԓgPDP 򨤊vMD@ W[Ḍ=3Fʞп1G^8Pr5X|GgYS:]Ae3%Z0R:hŀ,) _XvttSɾajF. %< 0.% \]BE9{S;\sU+l>8Xޚ]lAwx7QoQ4m=U4 /z0 \MuUΤ9ouX/1E@1;@K"E[xɚ9ֆso\r6'qB_AvSwwn|\uRX5\J*JdUdL\pݗ9֡QpP St[eYQYgB $ (Do  NHl:`ApcuҐ *eW%J~D} Es]gıߟVY)6gl DF((W7BT ZQ VTz KyE_mS$ 4S!UMJ2!i,(RR!H&BV dF^22z*,jaLA@Z)j 232ل%d,TQ0BZZx_6N@WSDY7jH#nh{,F 5I};ݾ q5Hf6XlR3 SEY`X*Yq¨  " Ӱ %d&j樥^#R- k@,قX aX'ì`dd. J)UȪ*¥"232(FU.!x"2)/UUAbfi; im+V8zy TAun@IRIp(_+oܤElGTASWȭ{\5l X(b(XhScMX*"\ԕ{U4I,TGk]8M&*G R%;0cQ5EPUTZe+;j4ɭ>5xj8V[%2T&VId`.r\XcTV'#_(_LڌhlLmfC+n9X,8Ea-U,A)%7* \*q.*nQE|,mj8R. he2^TBQjbQERpHխUTم]TE%*!snQD15`Z$U~-n+Dɑd#8 ^w%+$uхZ*l*5kXZ@,'sAS Ր›y53PTjli{SQfVPPK'i C 1m",@ .H)"d$*H) LE {Z JHRZD!H+nk2UTj|ޫޕdbÕP*>b]Y3;  !sZ`C HaR fc{% T]a}mbTa$dPZV*J¤ZU*B2ZQQUĢB(@0ωxb%KZJ%Y It^2RIf@@$DDZ #X"H,"(PdYJT$j%+(Jhmz1ujX"bɱ46*) %T*^d%H!թ%L% CIU H`70\6F`XZQ,U 4H0F0U UAB 4QYr+k[k[ZnlP,,$ڄ]1L dUck ޿w¡Ȉ !?t٘kC~&tYr cz, *%BAs]"D)sXңhqfue;n.ge-5gTMi;JLc=pّa8`9`6R2BFgC,?PI`A3._-5Y)SzxI"[7a 9|tYM QAAV,ޔ( 4_U&H%V "( kStF3wCl.-Wn#a81`T1XJhphq ەXUX2A KsӍm[GVjRZ*)fyHQ %֌|i? y D D)P@$T"{9(k@E@JE<l!qH ЏX3(@T 2PJ$kG#?zUх8K@@V%hXB 1mضt2Ͽ4͂QSpiE8v[!Nr/>YQl[$o, UC8ڊޫu]._n囋]cӝnUAD UqA\1BThXٴfUEF  96([7Y))Il.`S٦NbQn%E6li36k捾3ܹܞxnZ+zEwFL!kڅNav{mg%XnX).lQ.,H)@a,۰N896BErC8n 1Ae}P e v=E1X)PXUHY%),!@b*KK>;r[zwyXg; {p߱D dU UCdʀq2bŊB,I~ s "S:[0X( J0$"ȤS$K wh"'j5U36BY H0,B )hOF3!ضj̨3\atU*@b"0 AJ$ܨQ$2.-ףB.6Q&  ֱ4* dmjȩbO22Ab`Sfq`_ߩ d.TD)"Rn. F=5$<%(u*"`thiBD! WvH`")q0J`R"ƺ4JNͨ LJS t.$,@S!)uٟFptKɡ 3 S- *H."RdbfI6K f+C (5%2gf;m<1c[wJx,Tk\"7Kt.9 Də PBBMۅIfPY!dU='0-kEU5IfE$I<>3$@w ?CrI SY paUkUy/O>q7.ji*%ob3W>\13,˫;Vsia$lm{_7_/ }IT@ݱV@e]z\I}mIċUAq['0M_6P u퐂rۄr~uK ɆZ(,]ZoTe 6YʢxblH*K=`vpJEb)8LOG [khr44*7Z|Ax(zocc("7WQI$ \I8.쁪UYľ"8?/Aroą&Gs[vD%!$mqsp;ͺcA@ A@[@@p%","+"2)[W8_qz+ P"Aa"R@IdBEdDS bX>7YeoQ_p."jX $PX%G FEnD[bX"R bK}Gggtw7=&a,"1YrR$%HS ɼ(H() g>1dY"@BZd*TتVLT$>/rJdP[ K$PS,(,@,d0"IHP*Bb)ܢ-.L*P,̸1 p0)!H}v徚SN#k+34%Rtۗ)KR(IU򍬒7X<rJ3ӨF!8\uY3 ) 6ќ"l.f}G>=d B BF IjT}Th- ƃ*Js ZerveN)ͩr=TK6/06:笠]uuҪ(֋=Nw#E#u~ԕ@C3sj[s9o2RH{8(ETw6o8$ϣ?6 @\@C " A-=QEk3&Uq桕?@ɧ;Z{%qZY SHFY^vw2^NǔAO(bZ̀ # wW^gfii+`,r!^W/z.GQ_LgP2'#܀) ċ̐q"ENC&gӚAP~* lR+p޹Хn?)5 b Vv?N<}Eoy/iA'氫l_S8BEy [\Ҁx GGZ%<~~"7HPȂD i\(㥠n'*@@Rv,&@ݩ1@ELZȮLQ[BCGBȠH()Qw/B۔KbdmTJVب $ \%l" -H#m"#KFhlC$ B,`] 0{X%cb#dQVȘP EzI"]S,Y53$dpʢȉD$"d?V&& " '+=|,I $ t.)" R(dCt|hK a[ Hs{C څzpc ez a ] 5hЅ"ĻA;9U_#~(߇)b5(!zߔB Cu@}6KTzC*R.\FR+f{}Ob_YH;A&Ԑ4awC. I ;,Mܪu !}XHfB.|:=2ʃfkN*^դ+K:*@̆)MfHRocݠ FHeH-kFL`"U$8<:(\s$0B&Y[T ,*͒L/[g` AAL쐦 :EbT}Nj.!v5ȆgyS5^jԠ PMJnހL[e &VMEP6  z77wU 9 ɡHlh CW޺:٥K`&ZVAgsŰ &U"V$&_.gY :@;s-0EF6,HSRZA`N_7w&)5JCBb6}{RGQ% c`7oіvh2֢E/񡾅Vja*CNQxpn PL ~ RhcKgIb mGz< 52CNY)[vw `) jߡv( d2C;lZ ,X*w;9iC(Md40!qIj׮qx޼O@7Rj@P  dvBm$ %H [w/a@^;_gf!9ٻ(\Ӡ:+$u-u 3E˜aho!]!IHDs3VNd֡kK9\Hݪy^GB6U\%~j^C„fuu\;|WE6F+ώvc G"-OV-JB#eq Ēϫ^ <6lg@T- 5zBL|OwX*1x0 L8Y zsdVcy;`Zd )NnH_XLA]ڣ A4Rb7$g{Ү˾&B:D AkYMRTult;p 3ɈSf!3L( YZEH ''2@:+,?Ψ#O g+_2FI1 KAVϘ#.gāLSw)}Nߔp^w-aaYb4Vj̩{{Ć}}PLPrK#Vuq" `ܫg$z/bb E_Mҍ+mp^O~raY}ej#W$G=)uDy?@?W3<=!([R \ڷϴw??V­6Q ӊyRy! $ܪ\Y&LY"P{_|zhz%HpvGQK&S, "u}bQWe)nY0ʞMV>:#e!sNH.XSym ,oxGfP̧r[U8L%òE1 @g圵L̛!>, 5TS2Ɇ(}lCKa+&[ թ7~g7sƯ ڪ=nuGCGUߜeI(Ft.OV3Vc {C? khٵ+p;gsaXڲ-E}K1E=pnQĺ#PO Uy= +P3Fվ* 5MT!tFf́]3lY)vɞUxuO%Q[U\`v'Tk,r%W-dSt]4pzH !βZ K2]I aqrˮZBv{8ͤEN.GTnA#JB ~f\TXAv`QȨ;$4" ngoFԸt]ݤ1u7 Z),>~H .8Yk9zz!YE#ⶠ E4eRz oL\-.>D8Q:Zt L֏p5[Ûދ<1elGHi<)L+)/wc ]+6p$"qr @-󡾌@9|}1C3r+%$g3qd|M\gട*N.2)kZ_!ݤE$ C.pq`ina\e՟wbu$RM@Xlᕎ]y S$b{D!vr Xqϭj(nX"% HYm ZkŁIH`]@I*$BLRQ^z&lEG?UpAA&N*IyêkpmJd 5Icm6-X ŏ2"I~umxodyי3mYIB5pyoVTEga$iSj3. ljbu7kVi`s_$zsUWAxgrꊒ"$Ug9R  "DCe$7f vÅ."4* ba29Ź6m0'Ih[;v{ܳ^4KlAnhP!$@1|}%$MLRM.R/@ APdmF*D̉dșZM-| E܎?'Efd*2` .F%cU BA4[Q+" sER4Q զtG ԪZ.Rd'ZW/[9dE zAkѹua3۰zɨпq+H ##Z/H+ǯ"]v;lQIv"MyIShC@cY<7va۵wRu#B5pwҙ0ś-'^$Sc cx K‡Ǧ@Y9MDp77Htߪ,aa f[K\V X3I_/KFn+r1lcl,X6"-N.SJpqXMqL# rm;VGf <$'XOMvX ')fX%xV!߻.3Td~l-Na2*1Kch LT(M10j6l&f,mpknPqc Le0KS 7ԖkI.XjK7CEY!誢J$?Xo-9Ts(<11ƎFn4`Y+pʙ0sbIKTYs"% UT/_cܡ}ZRPh, /J@4w&Jz'C38A ufeާ_M?9_ 놺\ DDs8eo"_ oSsq!B!ݲCjޠRC!8XN ԄnBƍXE-xBS jKlC 3^X& Kg'44οTn1ߍ2"H:mf*.F "F3SI㤤PӧZdKG?Ga% RUH5T𮀟y@]mʤ1-3[1:k3Z\| ]Si%|HAH:sԳcUDU.A/1 ĢJGo9“Bؼw}*O ^0H˔eڂēϰ@ /%DDF2i_DzO"4P'WLc}$_۷Oπ7fW'zJ#P%t/82(J"[LeaU%Vaaʪ09{L-{ڸ(1 ijcTY9"ov_V;S;||]"G '_k= WKБFb|gZ/}swݖ{NQ( IC8 H":>`M/&sZ}70k0hS_{= N'Jef iPa XlBx0gD 'VF7 M(}{#^yed8\C )ysw.XJQ *NjR(_&Q|q]mgkZ3RRACAc΅@+뫟vE&a#@{_Txɽ!I&^ ݛ:$ǏM['>Qcz+W- ɵ}$X?0J F'Fu [@1" ;<@嗖aؕd{Q@a#Rw‚'R!urkօW+v7Ō;Uzhȁ}tFc6O T^[DzZ[ys ,6MmGT' ^ !ߢT'4?%I>$O*np;zKbәӮ{,3j? O4GH:?j-\-+$>2Lnˡ4SF 13{s8!˩zc [|`P2 SEVd\xmY61\!L2d'C`dF3}E o1f@ nw(!!>D8!q2A |j8;q咴?psZN5Hx Ax-2 0 t(zf5(4z`)b/m&BDt^@$eK -Ep~ ~`N%Grp]n3_v"q"$1D%PjDy@SM-d*^JKV'dF&;S:yoF@]0@9h(+pg =S̱'˜ml؉t|4-kɳj/ d ȏA7eA]ѓmL}z6џ$d vLAL0umWMŻCqS VV8 5%/m1mNVh:l .1QR3W,ѡnGVAҋ$F"›LHXR\'n嗶3W؝ARHЂ`JW!Et̅pg+u< a[,x>S^$_d|ʧ< * =BF@w)|%RR4RG`r#1+zFmB&ǂluBǠZ/ !2>-pbJ oH,8 )oh, 463212,Mcrҭ md`Y `@$4v =⚮UR kwy V }[7L ]wTIvy 2:&_f mnjO&t匸D†3!QЮ^oţ I]\b7+2`Pc)d/dgsR'Km <8F1 [n:]Gz9j8zdAI Dz *rA w'f2fAʚFSz!ȬTEAI$ Mݺ Rmiޞiй) _B!S( z:Rvj0$I*OxN2rPs< Pَ,l؈' i "u;~Brģs;Y HRrJu P@BbIRHN])9e3T3'B &Ѣ71?2mJuu^f>1fxq͂1z$RE$ 0¡hE1¢yݽ%RrۢɷYA5T#qI@HR* ,B!:,.f`/9}^!+*m w@'.I$NEWE,MCgeŝ>/[bNƁ79"TQG3\̳Y-)rG{Aoq r!z*9QɈw팆> &$rfϳ9٤;u^S3f=*qՙTs髫b\1^ 蠋i[>fQ.D)46QPǎp/YdNA^V}"TͽF48shkj?3po3_:8fՙMPU+b<þg#",5bGE Ht)?u uQ33y{ E K *%F- yUUAQ ib* TCx"Q85Y/ IApoW̠aa`ThBd) 'g;}[6)z" Ƌ=7G:%*aVz|H, mbS$ `l穮n=Ė|W0 ߰c<%B% 1 oGn ۨNJfCC/D+QTvɮ5vr!u˕TOl%&v|0DM>6%GWv+12/XfV5@ʀJ$RW:Z[nwb~d*:oW*ǟ?o8 Ȯ!񋧚D'iJl_ ݤF3]x[:|/|LuLU{Ny'Fy.F|Ob1n2'?E2,O7 >P"S5} 0m[P\ IHhr&D;ƹT P0Gl$: _IyBn~9`.!=Efw Z心[ɠ 7.$woiٖ쒄'u2g@a)RDRXCOA^t)GHa! `rl- ۶0HKpT7"Hw/j˚:cpttY+HCX rSo'wǘlr0pLu׳{|CrE1*ѡ{[0)S =IILBtIb he$鐟+j0 6KimT(_*M(2 #REkZߦ ]N iьB9#thJֱ+JԾA.y~:?`ͯ2k5^u;6A8qٞeءkAa40& iZ1I/٬Gt UBSUG!0P@:(HL+*Lkx¹i- ezږ̈/ ؗC {3dL_)nz{(B\dpC   3%0`$ wc-lŔ PA΃IAJAW[y*u4 &lWGdP R8Ep}2: ހ "!~(w~v%U(H""nRPXT "xZj wv @9]%lkZ`R !  )׵HAS` ͢M.5}uW d@T0a)@kW:"袣" V;niry9zalYƜ]8 Ą,%2%"\ YI "H謠"YĔu)*ޒ*/_׏12x#{kN1?[D It%  Paթ'M@m4){1-+VY.h:IupAq7ﾶu{%H#? )@BFkz^U?9jaH0IAC*"l`#H o^T%'gaEUPXňE.P-MzZ!6jX!K sӛlB+)`HvJ-(xz ĺ6wku~>Rc}>xC5qKJobPl}dZTY5KE)Jnׄe^s(YRI\Xɼ3tnvwOjL$ER.nw zjk@|3 ?P윺!ax@ Lt!(+tK'NT5oL}EskqxN㸜 {3!X8!.2 xָiMrJ˺W!(`Ei.-Et{[bfƶzai$6b*Rsg 35#m͊: nhd7]C RB(&?*Uh/tىp,r?۬Tr(YF< Z-4tGLu00ӈc,=q! 0 ] M,AFBTW(ïM޿=e':@ ("=AqgѧѫTf2i TR\Ȋ(D0Ɩyp C~V6Aub|b xqX9_.޴iT͛tj=jM>{NHe0ĝVʝ_7ُﲜW=CvjA+˸Zv&溜o Œ}G,',rDPʘ^},e蘶kdEt~|ۛۍv;ꦲt~3OfUhO8tC9:PO܈ce",PREkW<>õ.p1 eay_{{K@E NՆ'݄Hz,1Z 8 !5 a($ ["}m7oft1+2R{ k"jR7AB{IKU Vo}{9oVfJe$Q> $B93%f"kˠTqʊy9Emj &AH)I%U?-p3@Y;&vׁfI;vz5@JŇ C`w"/[XTOm2k2b0YgW OOf .o]M< _DM^G>F>c@.hsf3gӑCjIc—9n/b*ZU{ Ǫ>3p[kk$i+N-:Ƴ@@ђ1~8*d]+@'ywJ߻Nc= Z~ LjL'[Ϧr"X74FyڗH?BH> qaf!>A :̒(S.YN|YXg6Խ~g&K&Z; ]%[(1YO[D"NI~y5XL`q6auq{A7_˜I4!S0Wg s :$:>j@!Ty$Wl% C K׸vyFHE5N<"\x6=-tWl\6rر7"] ˤJðyݞOt Rw_Cjq8X Aw*Eύf93J "L(Tz䥹TkZoAd+b3IԿֲFI$ar\ OCeo0 s<99[ Y`(0ås+-#%piUG;ܮRb?NG,)I&@0b]{Ş.j$r SڌAcEE'::7?|{|fд>'[Esks\f@ORad"Bl7?֜(Nk R,уae`ݯs?[S? puSSV忚``)RàX|g!kH)r 8 (d,.EldJz)E@AEP/]P Q򢣅O".칛] e`;\#i< &㪪 iѱA.,6Xpd8fF]wVt2- em2 Ȃej".@60 MU:$@*L_[(_ $'"clϔ*##/2qa~M/d{EC @ PT A/9j(Mv\0WGGG+J wtBgS=k=ƊuT~87Y!@(#o䃤`Pb?t[ⴑ*e@}|?܋j ك<!Q|SGĚ1IY,ɐDmN}-j,)_t+A7qw L.aoeui֭-D -jP+>$/>%L].qʎH#,ny3gB 7=aɄ1Q 8Vur" BplgxowH<C9Ojo < e{W"@{t`drWl/?Sfaa:0]2m>J T=:5?PLk;$2{x QM׼zI<\G ŗY_'8Baa7Ɯ  Y9VbѲьvz [S;1iQA52R4aE'1. RCBul-LnvgQ5i߭n? vS'^u94K @g(4 ./ڐbr} "};e i03pp  B%(P)dx8ʞFo{x1K4"̺G @ɧ%57n7HhL>8#)QqoA`HK>UM6_ [BJN z?eKuD{x%R m8t ZC`j+f&Cɫ\LCCLu9%m YB˕۞ߟ,& $ X9RȰdjLRϗuSq<UVSY[;*fͥ-arMR'8o3R=P\ziPJIr8,.K$  |dP_M&]Tg03^Ȑ챲/7 #U4W9>deQz|~?ee|%[zG`sܒG6Yxe̗na=ѥ78㍩YKPgQLx;}(dpSdnxGA^= lg8ֵ)s%x ^IRK,Z'tq$jdG-Mrr>vGlۜs'k C jo.(mlpPMbFa{|$Rip !ΑBЂ>c4[*Rw>x>y}?zoA=CuS7ww0 XhYX&Zٰy:6\ős6.V^P$KiQ5''z ~Â8y6Mkp| bh v*HIfu^cgCA$-V~DF9&VKi hw=D2@] Xs5<\<'w:JH}F^AY⿣X +2t5cVk)2QQEgߪ_x =vV.]%Hۻ,C#^@dg"iXe"WXk^Bc61,laX@mX)B,J}p Q6ͲM*2`,)g! "whN`\DUƕy͞Z(N9N؇Zavg(@V_ףk9pm뫟DdԳ>a@XB/ٴ9>Mk56~Ԭ'z *'KFyk- x#!?]å4/߮{$$1 6݁Fˬۺ^Z*,^I.мo-Zb$ڈ4H`)({A-'I8_Pj &ص!"ܱpN\2>lY {nZYX׿8)J}Y+Tǜ@GpcfA/*gbjTDa\ AU$9lR=/Jr?HxO$!5~eזۨ O 0ͷ̕fcz\u7=9TfQ[u^- r_PϢ`#x`g=%1#ܩH,p\ґg!sJN#}{ k E]I%qNzz;F^ ۽ Iw^\aKTە# u鑲^W@m 'Z]u2aK}PS>GFG!W7 CIˉ}ηk_1ne?;Fd ӯrcT.*̢C$'X'2gpM-IpRq̌tBr x8O~*rA oۍopP0yؽ0úM6z2ֈbPuD8/Qwِ B N,4w}/TU3@!o,bVy3fR{,.fgHc'[Mo :U'^>9d#6{ц2_H I5%L~aEjت0# }=7Ba|i~mv`* OᮮVZ93c2eS*U`'9$ [DK"ؕ Ȋ[G+ndMlXjecb|`αƊz 2!:H !Dh@3%JزR`fv3]eP4\' : ̓fw| ]\3n\ԗ'0! dh;-j9;;v}Y[Aals&YSD:CLΙ$[|jh=FoúC{굶/9 0K_} K4\ʦ4$2<(Ԛl^ZڰSmKfʺz2^-x7b\)\Ll\ @. U>vAdtȹyITv7S#Dg"ɧ dl“E@ 2)vek2Ψ j˜Kfl}b#VX] MI"f*Bix+KR[zCYh{hӉexZ/nBYU %LbW284ҭ`R}:zrב`}YqMp14 ?FvG̉h]p!M4u:1ʤ-:sPDɼFL p^e+\Pm;OI™4IholMKR#T$BUw΄_ua gb=VFlK|:0Fs_60˸2?;.TEԁ ?U5}whƒG2ha_"~x~*f֏4&TvB;d]bz!ϕ)6*.[K14N0㠀Hة/bݩWUvO $7 Dp#nt^,m]"  wuS3tpumLB$MIb(3D;Ur<n1@#=:%KNd&^vg90t!1qyI4%DPt-ZFI#JC<@vI)Ԝ)~ȧi1GΌ]M5Ji4UYq #vNw{P.fNzN 0 BOy;e_+eSm$yTZǫ!zj:%SzOyW7YHAA8to .v`v-ލ"Rq B[sV`P1Ce**7f;I\[652,94vc9MZ=>4l+T̙P)S~?˂t@0S+ODN(Bߩso@ HRD}NXts}=w@p$aҎ̆˜Zol-1?Gor4E'zfȹgA9g=i=k{@i1;l8K2 ʙNn+zqz{+H7djuwl޻R >FvUw[`X)z $א t!עGv}arګ_K=(|9҂4pcbz#o..7."[v_[mtZ}I\jS[>d0WoSo$5^F̉C}ml$Jlv G<_cù|7S% k2يOp7:4hIVtxX:(7Ɠ}>|/ur IQL 84ZF]&^= l!4rٮ8A J-TDj &X@IM3%[` 1" >Fww߾';_Jr|6.s?֑l:A a*.@/%rS8F6L!! %rmyp[8N_h{H9W!xHbW *uo>}]EX lvw,w pUPx(pKyN=uT'-֦t BHOͯZy/C@3Za`f- 5+'_ad]B09\&U Mv/`={)OꬻHn1@>KTYe2ςe :8/;,7=c~^d*ar~9aDIhӸ-)&~;!WsFoqSEDC7 NEZ/fKt~ѕ#>_S8-R{S{a>J.qϧC]: h* 1 fwD+gھao/:T͊@F]U ]V52@%oM*`}FbTM+ "]`l- snrxr2+ eargD U <&$zz/EՔ~BҀXF\+^pqX`e@x{¼\"&/&?{u8+3F +/ҚJx~~8ڔ(ٟupǝA=ƐENᴲsՓ>8qQW}͋5[;k [(m0yq'|u+( K)6@h)m+u|{wݨYI"BCaUpj-b|7 ="H?8t. $X;xɫ]8chs }j/SZ y VDpˮ;!z˃#eVUR aC?S\׉{JʁO0аdh)ȇ5j"$_xGEhXs ;Bd`.6¬\zTJ,I"&<ِ l#_*d<9s|Ɗ4,D VJxz/#x'TSӕV!g!-#St- T#}pu3hT)EE \griv^(P@IqXnt ͙Is3-PYn"47H,/٣4Q,={>dlcb)\i2$%P}ִ M0ADS+}¬U~@fYei{VS2J_X2)kɅ6g$8;m>dZr> -Dx5DHAH.C$v- яT@Id ~{0aotwpÂ"0hoŸ#rA-Iu*m$ :9D(WvE L/m.J:iFJԞ ob>[题uQ3~JlnMxy,kza6g7»7:8O)~c soڎýgt*$h6mPl ڐM=>Y(gzMiܡ =i2 1PЛxKbh%c)kܸiI8e1:k=r&eY %*$Q1f#&H|L9$w+EolB+f6VlpFҙb-:\#Z [ɝ$Cn.rĆD ܩpN E2y=$+2e$^!,Hr\DI(Ή-ZXla%wG݈@O2ə0FΎgHTPʊr_ r A8ݱ{myWyn#})vX4hKBjdvvPLNkgKzcY蟪 f|PZ⒑ #ڠ 1HWC@GrT2!_(I_Y _~mFFvOB2S5S#?FI#Ns*"b.}j1myO^XS l ?a¿XpP`#$> ١*%kAWӕǼ5!N; Y(Uݤ@@bt*RbxmwR?ŦI+)߭~bP!Q@ݍH޽JdɭSc  tVڠ}͏DN V|o#$G6#Qs%k :ӑ"W*M +cAOV6 ЎoƘҿ>erf&:ksX~ RDI24rJ28e$<EʴaO>ZÃB6*z\=%9[hᴓhep".G2"Wd@)ϭ2|N@̙HT@w[?tWF}'ES [v7 " HUB2E~"7zǩ쬉W{M#4A"D >G ??tyoMwB֥SJAZBjǃ~6.?'3PިnQEƉm[9g4}?)]9?˳nJ>0{H3W0N\}@\:žWfLB !u7 ҂+[ `M H. |NY 34jex4kzn"P pLl#h{/C4͓i_<# ʞԒc@9&2I[u7j|y,ǨJ l?n^ B/0DOj~ qiPxe-tQS_Ng(O-& 6[ʃ~6$yW?=6rX vڴT;"X3֣l}[?9z^Jzm!8Tvs$]\Q VeOl+9ULc^X\PƏƒy4ͤףm)űAa18G9 g" ms2eek`v+^rzU0ss<-kayh]Poh\۸UjfQ!惑?P _.=ˮtsp 0²eS}<Qל2]q~>}5<`Y)=?bgpe"؎.eC;zqyd`jGqE,؍|>ϓ&Vſ(~p͎]|WRg r]ϊv_P ",  rI=ﶱIVDLm?FwN"P y3:~c}OpuΛ\ܺoRH)3%/3C {uEWfma4Ř%ijvv:H핒\oe A+ ~ T;?H@(~IʏVhWe(>W6౴[l82MLS8C[mˬ,~5KA $ŇJ%cooyލx,Pb 9YFёhŐ6xC}3ة t~nj6*WZP2VKj PKgSi9MlťѢuPH?R2( +.@;yZg~hΆ:k/BjZ$D @ti^J:͘eqCgBe~g$)ו%itqQg_YD >\!sH Wn DgtVHOmN]YQ Sjw'UQK|ԤVU~g:KY!%t%#$L@bCpDh0 mPz].s;=f,VMY/Y4&)QErM/V;(p!$N.ճ P(OÞFv T7kE]ʐe m49( OL8!DU{gM]$.e鬯w8Tp3J^Jv-F[Ff\1]W˼f(}EDf\B*} mqs?lKsmߵ%ۃOIɜIXaJ r[0-R-9tPB^}+_P #oJQmᢠ~q694pODps(ƃ:{Kq['qHcTI'-lK#չ(-/;csd6jxWgmvQ-{nÒ -`X14 b"d1$UD͌W `q!ZW&5q?b)0 ^:uq3a>RdsUr u(?1.Ggp\/pq7[ -Ү3~7|0༄:.* E9l\6WGdķ.#:a-QvD,t?υԆ}a|H"G'@Wx('v}#g$ 3cWP" }:fy4Y["[탹7]Y pϿi~2vrfRY>$ed_} ]OBoӪbHA[>Go)K G0c!々^Re% I$sXa vB.zx8L*t&8~7N〲In5e22"bD3+o`3>?u Z2!IobURor(re:Ԭś?む'xR]2YNja7<i1* IKB\HO HQ$pI;ZC"bт&/i?c2Uf^$ݢ,_JAV3V2bI {[ՊUcY,(vn5ZGķ>C;L΢V onR! !ǵ&A9B;f)?p>ל.2lFXsۢr`T1y&5w(@ptN@N8i'ݱ^-ohJyϛAYiǀWyY%qݚX$Z>`IMj-nѠ?C#Jg`9-$Mf<]b^:G"?a\-ךFg"%a1,aa;h ~ˣq&5E~[zb@p2gU1J`E ېG |chgfh 35okGxΚb#GU+~)Htw;eꍅ\4"ejr"ÖYGO:<|?nBTU_E@z% "2#%[]"9jU@!cfcO* x%>6+H [-Xphr:9rX1gmܗӌn1 ZϦzeb*rtj ͊I}0${<ӣ)@ (x[4l=:vIobN:NCb]HA Cm 2ػc viǐQ4x*]H:b9>C;ymJZ%\Wġxfڄ17];/ [#0DCNMU=lUG-/hѶw2FМh3 !v5kUh%"-g`u69ԗ9#MЧu "H:eNIe-V4ЋBfZ&nqoKasZdMGpjG8X0%sw*2/`䁼KVMGaYO&B saB'-7OlRFYA(}dCv Y%g}fռk^i7{Om $:ҳ=QSbڻV?/ (AElf RЌ.{Z2}鍤S5iJbTQ1,e3'{f.UTe px# F}tƄ*9ě$zW&ЉUxG5Ao(c]VG:d`[,Ay{fㆴKm9NPIprLRA|]dV> "3\H*H.%JmQ"h $@?uzQ.MwLx=K2 D (zPE,鿏wa14cli*š֪W$TV&$J{)"1[AFY;-oׯy;2CXVֳ Sн_BOw=3%ZjSvw$hb(p G+y/=2W$sC(\ɂ^Ť>xB*yxĘilrrHcG6KM' t yZB 4^LYbϓ:YꊳA)i[bxIqީ2<1$ yf/$k'%#,W&-(鬦 0H _asVŗD~)J}Kݛ1vYx#Mnu- ܝH1gelO4ң*+} oQ{b~HmIQ;a|+M'bL(P8 VR#\3=6 H$:D ހ(NիM`oݏ2.Q%QD!$@ "?_& /YTUƚV|/߶,rQ#2 I?`(UE j[lj-sj!IAg`IRz];,sdqiRE $9yӰj-Yyj([xb:[d(0m˼\~jS{[71B%WNiI,s>xK||^G/r_&1FРgV^H_>JQ3׭\8'O|',:gV8W/4.o50O$e!ʜB yq1 )Q6 lDʴp< 5(sݐeY҇- _Iem˓sB(aJl iȫhn"?|pdm $JYFw)!>4s(jRP5v^T{ TȠ8W6"/}*dڛj2JxЕ9E2#,c;3eT "6 a(BʰC>؛T)y`LXbq]T&I-Xx0z> 4㗨L{}WɚZ]n+Cl`8$4s& ŊJY3qg@ȔjQ䔀6(pLc~<7 ,4TDc'$^,ׁl=#k D&+@(4+7!VWG^A6&]}λzM ~Ȃ@p˛q gLIiDLzb$ +01 AvURʑM5ǴũDdCY7%VcԜoڀ +;3E[Dll& %+[z<pvFT+ܖ3@Sa9BWk;`*9sQn&]~BdwPRg FhDMA :?V^`b`.&( ik?]%kW'\*/l~y|eH1x&9MNl cWyNo:㊪XPMΏ9^om/ϡ1@kIC(Oҳr2zRu[Ř /P'0AcƝ.K3q<>ˀ}Ĥt0!| % }+7EtIq(saff* :+&$RmIv9cQ<+A+uwm/sxZa%ˌ9fAl7-B4nn[h>6^ k U fͨw(0$ EM6_\K2]qء]j'qٷf܅ ѱC$c jXbouֺceV٥8Ԧojr]usS]Жo\7ΌY? /EteFEr¬ 9 ؐ<~CᦥJEzGr e£cfІWB%fVM2i}nN7CJwB:>(SuQ: hH"^SB%t>Osl. 9[zVm=xʣ,q WŘ)NSV>@r"4t9oک%E,w4{qygV]Yjy VȍbJEbj$ +z0aXIEM =~tz%zքɟL4eCe&Sф2rL3i"A}aT6 m?@/| [T^s2L G(<4#'xTy<m/y{G851kQxpdM PHj*+#o{%VֺYoLA ʔ _Pz"w<# &P,"@[w.`\J*6S_~u+%kROnV076ұ%؀yv6%U,L,L߅#P#a"?B`O?]!k7;+ͯ~ IP5s_ȢRr4S=n58n_0 Ad@'s*/F_)|q5?J)jFS6$aH[/e츳x=Ol{VѰmWUҲ.d @Br#$s~Ӯk+e@Q@, Sy5'׾|'üZ+N3dgԦAHJx)(g=%Smdt+;kVK^Wq(\Wfbzhw>R X &3!cѽ}=R4}$Жw9{+jnz84o脕DI˒&ȵO" ΃ pJ(j]er ړB&7v.DgkG|g7I"bODh~ipk)x۬rU2 -QVPfƐ\rDc3ܳIU/ҬCbKhNi&$p< wn8+JTkKL41PquR@yCgȥ۫."()'%R'-+* "/KnYDdg~H.HJh:,E EUc-sJa58@u#ѝb̠Gg"1hr BQW)Bay7On Pf|GT[L!jAaXzE0Yi0c(98ޑ7EyHVK>bH<ܺ͢R-}Z6p}T(YNF0/|<6EDMUm{5 a%|(i((,7WgWEh I RH@,PA@  P ,#AdAII$T`&)oB8,M.a5} Y+"EUC`_1Da( 8Kc|9 8 $s{0Q 6$HDyeg2V3絒z2UbpsEEquDAUݝ] A~71F9?jgi1M7 عͭ0rdC.Yc)׊hv-Nsm>pٮNJ:H CA X4G]"fm? 0&q~K |C톕%٩) tY}@;p6ٗI%"y j*` >]q,jHR(w$3KyÇaw@w;n`ϔP(N0P\웃h3f ҃uyD]sy,gߣ' ׂ1Vxx1Ə5OVhb}̦(K^oQbRl\_ѭ qve]*{-d,_gJܬRfQ^ _\gDE#8c`C9Nv"ܴ`b1^]J1]y_0s3筜ԫ{& MUQs])?R>ފSx_0# 45䵦1Q"&JyxBm֔Q#^ ^bFH`kUB.`s͔FPE_SXMvzl5sCYtɍIt1;o@tYQխflƔ d,uo#ǓBú?4FA(LÈx"L.fPmS)%J$7=OBfZ)7v ZR|7@c xtͭ4 <`|C R*{Djܚ$H,$IjM2i3b]/2C]SE5F ,K:il y4mDEHn\)pȄ}bIvdnQBP1yTH{<ʛSI⊥QD0,&떪\nC^ԩ=h*T.9]%|fTre;)d"+Eql%JMn͖URN+VO@H^B9`s"bMSԄrQ >6mq7$j<^W6BY $_N%h2ΖP3~AYa$2A Ā)4:;: tEB˅gkBf'vD?_ߋm\CaT=-;_Pر.@=zOV/ ~pjv61Kк,;4/o3ֲ(@@ÈbD!pyU ,zn̜^(Pal10vP&9= ^Njh:y&Td )$_ }&b;]{YCJAi,-Qgg&"# N(aG] ҅?|CtuiLmG)dYϗ_z.0@yIe!!Uqj;.sz[S݉2&z{"~)~baQ 0= M>vibR "ȬH ρ,/eTLfI sAD Pt1oݵB] LJwtΏ0OT[Zճb!#ͨ[Ag> ab |ݒ8!1i8@8 ;ߤ 98˛67齽v 26PƅY_}+o}KyOOeE9w _0o1cyw!r.p*;8tuT=G^P7Y6nVo19}41ѝU]/v6 o;^2n5/fYifKoȨb[Ni%T~e}Msg9إҝKN+#c&UlyJi:vi@UJ yR5 iza+\i2wDsi@f…`[b/Y ,2OFp@"8.9 IX7N}B2xK$DM%i2Ad qlLpG ߾O[dR"b*&~b!v&[2xW-?_b^PBHvLU]+cPy Ȩ\Q%@ Bm榬)Yy $a`VRJ X  F]B/d=iRn9#v(8.e5VU|) &q/}o ptԖ65-L҇0G y,55bCE,I噱:pö3=Θoeu*4U !7$| ,J r&ēh>ތXJIwfbb́4X%r/Iͭ*\wW\Qn7t2cJyٻOJ'8lLkmf _l*#{|#oy2uZifL! ʺ{ň7t2eL~&*Dn_t>''+hllRu@d(NIIq;F;Y̫^[-á>xZ: dWj[՘ pL5g@ m>! R 4!)>#ېTr֎RGe@Zlٕ|8LF[$J,<cxDn\c@]-eSs]\sa~q ʰG\@ d]/a0X^T, }W!i%ؿ_]J{{I)랊6ZiZ%9h1!f&7Ve$A)6qx8I5K6RQ/ww_*ry?Ic("ߏu ]zlʐsmѲ6CY3):.asf2,hZThMM i.p(3a뫉R WUHuѝ6*$|Іo>!~oKX[BPO۰}R2&-I|Y*xE|'L9 ޴fܠrX>Z@=n0KD+kM=&,OQc(U׸ժV0xe1.g0p4@<-5G]+f`B ^SRO"}x޳ŗ%OX|eB +Զ0V㷅eZ.1ߛ5}^=s\Ēn_ʙ$d28R1I~EnBĵ 8A_uГeR-13|LqQDHvbt~+n iℑ0bmiP'= 3QY/rD)UkcO4!*8MUw^ dOÛ*c%wk._7UPw?IN{OC"ν8O1, xǸR C9_C(|` ?IR#WЏC"пP'+B/PIj'疺G)!X& I _ 5p`Ӵp]3ggj' q>!4AlW6iE^<[CLȝ(Q't^W;:u9s/?ɏ8Β,\N^4+K- ?SDN`t45A: W̨??@]W8[#v;;q@76׸:mGg8 +gbfU[>I  \oK_ iJ́5=Zo +X5wy|="+f# }UW# Gz]_ߍ(v$BquS;yfXr`\(IJ/te=nϛS%oK>gzj vRd^CLMqڇJKDX)3ق~4Z>.wcĹ\ٜS{4.L'ooYϙ1#4>'kJxcAjͩ=JIF"7$fl/n aB o ?WK:ӯ1&lQrEj*c`\ٟ2yzmt6e,[}}frڬKu\q5OCx*Jr4=/ihG=f{JAUQ6gĎC!L5m3)"FZDETЮxթ'2#3|;al#7_I#ۛh\le 襜2Ako!z;p#h`YӪQ 20Ҭ ;!=ݲ{\7{gʭ\y1c$k #'$sܢeQ<|itLɏvZsȏw7zeӟV;9hkQw;f)8d&d)6hgMBc[8 7"lR |43|+$Nvd>'%?}lmgJDeR9JyUʫf|Z?'M3JGyt.?FԷ.QqqъV/ahէ8 [֨&ɋ $ 7/fj7`gřyHH'"RCUfW,rݷKj$ UH98lpg߮m[޷>71l ".x]w~=;Wzn`J{ź2 뮄 <-Gy翋7qpg\6,o0C! 8ɦc/iQN=O0.bUCvmuJj*ލ`㨅I֮ > :'?(|ƶF5hT v9p(6"pA@yywr5ڎ|*=4s7E֜Seͩ'|EN Q-?] u+<_@9_~hOvsW)u[F:Uk:D3H/ń34?m6zůg6gS`Mi6\846;E 17-=l8(fTr[CF暫0id>څ|Uf_W~%6 DrwPx8KVK{[f}| ğb+fկ;,.w^݁*}=JbDZKX xR%t v =PhxetΙШ|8,2H9s]p>$H"E2BBɬopO+ɓ2v_@4RE|Lm0TK@)ؠ[dmh(6A*Rlf_ZYWµon]yꂊ*D6xOP{ĹZ(@y8al( W%4Et(_|ZhmuAp/)YFk8nu-zDwe="_HҊdIhXne./Lp|{jB"%oq H?i_.!"$T$2ϒ'KKicRjS^l&lTe8y s~܃ǥe"nPWO}5NJ`,iFԛ3Bp TWu\ԍI #+B I j~ɓREH&H#9b:'ιw^{FKn!hM6.)B Nb)!/:ɈJe:MM8{˝%T΁sQ6} Ie9m-Mhu޷C34߯ma@@b}oO}[:3Tr?ywgaax{=Z>D]s[jH8ׁsJD+2\Z(P,tN5T.w2sۻ잫F-i&HzHﮤ%|}C sMdbB|%y|{ GR7Q%>fŅ pzH]]#YMzBO©ղ^ 5&c=zOooS:$jE60ZwR'͌"|F߆ޕB -cn. !D9L` t`{ffD0Qp BPA s^oJ`FkqYYxTJ iqG!!E{L,P Z2W\~Oqq;wuRE{7~ 2Q 7eZ$g HwC (.H'>W)DYVz4IdD6tޤ` Tde[-?֟ C+P( [,BaIEk(bdSR,pG0I7iԒptcT)rJ1 `8W$6ƶtqw׵rӺ 4,h ֜dhE[I@%Φ#xJMUhZy}ixImX*@VqSO(!ijþ|fH4Sd Z'ALu@*11e.џ[SXe )#w42U&V0KG&Q&E8|fDaLr_.zѲϹ:-;vbT7^@(7q5g TwB/K3U I)]IR,8;!/d.`xsULh]oJjM$ȟļֲt4H::H B |<8w2Y([횂-߿+GЂ:)<'P.rQ#EeݝmOS؉ݻuȸ ֻvʘe(̳<[N6m\ ϭq&@zŒӲ4đ$&$wQ%ⲰQ967\Qd6 If}m5t8"#;AG&ڃ"*q]@@F@EEqwuy{5Aw9Â.*KXK2eU + B<&N1H8HPUQ zF0> GW|;daURC8ˠ{ym[c) C K!O"8JM.6 &6M|X&p=p@ uxm9YVa)ٲLm-5|aJrOL_g3 :̣}=) iA@&f b [*徤Bo<X@ҫL/%U9*a7b!>͏~ǙǴ6h1FpTG4MQh/ngtIhvutfBzp/{]s}x''sǑNE~F01N?.S5bL`h֡ JJjK d-# 1istȢS!͕GblN ׏2^`}ӻ%B@csRBuSaʄ1MQAj ˯Qd/wM˰-mCbk25v6!Fēqy3P5fi05܄hx:=sW%ȫn|{;1I Wc!ʍf2K%=t3d&#M䙠hխS?+3/S1"'xV(&#ZXT >m':e*cӕ`9VΪovXzܨ< Z>ٶ@Fm4Zaky7 :t$?1D߬a)聰)9 dm j1#2ﵽL/C h/&9#TX;QhȇopϖmLKz3cz!yu=;SLEj!\=R-XRm'XE98Ԥ]\Fuq:墳mp"e,Q,Q\,ʛcQLd+3ѼTe^6a=IYex>Z:{Oh+܎D-5D)[d=0t(w!j Ed5X&L<^4g.,i LS⛜8/UNڗCT`Z󃸄b(.4=%ŋ.G9=[8a)-VKXĒ'/orY ÜI^>1ˇ^} )o[b̜8fEˣZ8 E'V }iҡFDukKv#u2k#^T9!+@1!}RbYh#2M.R4)9` OxU3D8sn0rwrJ2գm.6nDs%ĉ2raB"&s E\#u GeQ s) $'6Ym+hX0_h{B iN#)l&U"?K` qu$ZQQ>۴rZ %. Ŀ"8X6L%dsnJV=YAUH`a^d}Hb,dϨ#)k=(Ogϖ?=MYNkZeZxAЕ3%NLDRKq8t8># ;P[ Srʸk΢S6vWl$`8$ * HPn䚂HC+amj,bfJ JHo 34Oկw,{c0#: gc.;/{lDŻ1$P@y:Vy+q2)JmBl߽;2OGw.wRKM6+>Zqk\܄u21pVq0<9Ur#W[?]/1iyz|a>ШCCFg*Wگ?{h?(n)82̅iV#j9 l+E# G6fBcG1FY :Cɑ3 [c&RJԑD"_xy[qZ XmYynG T;=eY]hLڽ 8ITfdN"d Г;O&py)c%UX"!ko#*lY$mئlQd"cRN)\+W)QY~hO9kQmQLn,DEIw ѓOr1ƒ ^ra@F Uh Q%J"2q@mC#ALmKf;29']'%ר o;,)tJhK'vZ}zZ]kT5 &y<4Dsp0} F#5p,0}(Ae-|Wu\t.ΙP,(SU"ldn#fEa9pAyDx- ayq":ꭲUȧ9h "L3bf,RG 9 9*X0`:58LHs8b?C= >၏ݬ:GiHt2,.94L&W_?vu5|lz{KCUǗ^@e44J0ww+; #4bg;O*"~S/f %6w*1!R)C.-FYM J\Q)_'PoGE;\_L>\n+d0mϯ؛( Yڦ 7kid%P;>d{% 꽮S_U׿mO9Q`&y 굢MygU4"eMa[()R_|reb<!M7L,B;jgKm; ;ά$p$@U\dbrdZ9 ZjXtgϣ!ף/pRk6v*6KbqM-s!9tn1#(|b[,M:4vDVl5Ӱ3j4afD*'A)_8rǙll۽J}=gF@P`=F7ſ.ۺ4iAʈgggE Ycz.s Żx A9h99H)#\^rrI#XEҀmJܞRq}${3OG&S{-ԟ;i֑5kڜW 4(X1VE}՜@BE"Պ_5lr(c,ݦ{2 @ Q.d^8SzU/;<4NZWBP~f~ (=i0skJGhe϶d yC$mlSgz βţ$tDT,K8^(QF3293!G!fbd2^aFa9Q⸪LH7 ihN BPH2 cy%(8.L̩8TP+e+z ݓ6M2+O%ɏǵFN\yFQ5PLȾ$0K1#̔.ƅ/L)9kc(BQ*qq7:C\ hqH2_0:Z̞J9b+P Ai^/$SmCzr Xxñ7i1bHOۤk|g?uouP]66j4ʬP 7u먘dmV+~UrvI lC2,^|Y/Tj)d¿ᢙMո!N{=N7TZ OZ:Uʌ;"+" ^. 6لUZ#tzx %AZB3QNr[bR`#.@Wl=.fp"kpg b>g`~z:lBIѐftPY$LpL\lۜ>G(ѮDD;WwV+tӅ'4$\r( jq[l-@L~UN%OcV=U85[p9hFP ZiY2)3ۭsGsVOs,D$b6W(~+iP2 1e#@kD#(Y(Z}.t(3yAABhՒ444_}xP\"]9^pvف1G'l~2^@8z* JzO;Cy&O/9z41_*IӭxUULi/Iح(~ 9#I.(Po}9/P}ခHzU2 ː6iJ_POQ?mOD r'u~<ہ:ՉCdOL-q*lGob0۶mi}VzjA"w0UDbjZE>G# n _p[994Szߖ-0i񾘜(СYF͒-!=4S{0hT.ƼTWBwQqK`ݽ@y)# ]IX5d"a-iv5LZ'`BFBC3I m(orj (P:_A>.`U |.#&Zdſ7L $lAŇk/iV':5aMfvgHx]er=;qO],l9ɬض0| LZFʐs+/~G{C9n_l p][)}3X.>˹s!1\>qQk(1%a9czߝ}սf} QQ{Pc|yȏ˒ kZ$RݶT4@y=HFD 4ۤDW{?nrƒ7UC[x5 x)vwl/lk,R5n0&I\ I׆89 rxVg 4 RP2`Ψ, b^0ևߡ+Kލ2PK`HdVCJ}#Fm񲇼Lǿ7W1xfiBk2J NůG]߆=`ja6dIG@.'͢Eg6A*<8wH0p_ȫ1( YřV.<"ɜ#5!&W]h[+f{T[ pٞ1֥ڳs)h[U .y릤UI[] ثO,X9kTr+s>&`Ϻ$8 ;ʿIR91Q5xiZ]& UfT Hf"\(8x92FZa[CaTVdǥ4n>WN:A/bHځbNex/ 1@߂6EY)ܢ" `Kfx_vL=8R $-H0QNOQP 9K IL+gP#y' In2f.C5&"_2PZHČ*J2\RK3cVИ S B$ AYZ|EG#)'ur%Q`&:ڐ2BN`l$I$W*tM )KH/61x~l;=3_\;^m0UYlpe˯hi+ƐvVN6Z#B5Ɵ~:=r#b6کnڦMr~~.xI ΅,NWQ9r3U㼓C8yUzyv|MlCdο4Bq^y\ia!-p.&:;r1"; \f>?3tP}a?k'u!G;f\2cZep CͶ{ײ 继L #-Dۙ1\零"V4 .mVrnjtfLD-䴘led5 OfՉ*Am|?/O~>+pn $JL#]p'˥x񕾌ORw'q'r XsR^2Sknn%DP)ڥۯlH "DKQ)i l!1q~߲1 jcBf$1'ROu*)7[F4a:)H#V%10XRAUDd`a-j,m@ R bRBɄ@^oZgz,Jc_iE{] q( 诓dɓߜB-RIn39x7>G,m,qTXgks:գB- JhC"x?e@lF8MP.x2vOwP,6CҞ5{+^ԵW{@m sѮ}8;O']f5aD$$E\}? a'(poB w_/?G|N0;,u3{/\R$ d$T@ dH@@PIBDELZ2D b\H%FM A#XPM*SQ 6Қ)0g{K=VX/7Y=_?w7}>M'uteh`jBb "~>7OM`zU[)LJoٴgŴ+Vd)J,/5܌cY|MXՙtT EAA]Lyn3@Yƙ1FX 2! ""H*""E"R@d1B* Xc|nN'tk6D5ak@&dD ]dӦ2LŐEmݞ\iӣd `iq>>c13RI*vZeɇʤHYXsKLߧ2LU@Rs` D]ԋ͡QtĐk.pV5Eq7o h71 U0\Bf8MuT wVήzkVmF)KE/Gqsb!!'AnfϡMٹLUi)Qkm^#8(B...EL2[BC~D @YMhӕL4sh1μN[59٣[ѯi "0eX"˜ "dvm9.5 okqZ[v\[^kZGH"3rih`R@Qad,n^ -UPb(Ϊ`.mzLd$)$d,`A`;/v=?sN(];MtujF QR㴬L>ggҺQAH"Av QW)E$;~r;i61sZ[xfOZ݂vr~AHQ /)閆u'P r 7TE !,z/3-: d3 @sZk;䣓N .򟬺'9ٛ[jB @NWtխ}6N<u6y/~qa6QlO.p%+6%G tppխt0{d5y;._F$4f)n[Ia&Ƭ88lⳀ nImqLU|}Oz?qxAAWu 7HX;:}{w\:up-`g gF<} >fMN4l *E` |/黎׃N0!k%3 .2Ȉ"1QDxh*9F pK>;CfPK銂!L5]cY?X='A )o#@Xy)mq6 K!nN? :TLHFl\4ɧ9Al"+5|%.TILSӞ}+-/KZt;+K\1NrVkȡ9sETySQkEIu&zwũȺ o‡eW? |BGS#Jo_'71<}>9XeQ.e'-b@YENoMCA B'S }u J7Zou3Zrg%$$'zxzl1;ȱ@ Xq[tIsK,t\$YSg]Ȯa2`%ur^ x}h+׏@LM\یw0yHG`$͂Vg\*SE:[Q*2Иt7$}}}bȰep$-=Ueso[no'Ưvр%Ȃ5JڹĈ>,<<: 6 =l,y4xBYy/F޴.u۞&p5PsKHx_˭9:̎l%)\dVȇQn;+U]TFEgA8~E"鼂r.;rwڥ-l\oe0P%ӊPS= J[n4A]?jZ^QQsWl#srjWp,qϬr= 2!*82 ?2YUV`dE%;>fz:nL>7.Ѳk0iսeRy47?|<t| K'(GղfK6 m8L\6N!?'P4D$cOBI= үw7aOǞgd@ZSTvYoph#˖}=4h]#s̼#Y%:"쪶z`A_^'%7Z wun kRY `qAH1Hv4BzQ mV$v0 R9``\Ӝ,h&/~R)JX,C֦%Jd ĦBJH, HYJf|Td t!sI% $~8s!1T>j>T T/b/-v:jIʼ0R'{\iއHE*p>t?2Ұ\Bl8wv(ZZ[l>y00 bLR 9JT;\mꥶ- sogb@+ǡ\ʎH0 't1@C)PnR2c)(XH۩B Z@ArE#5V TlP2r96Wg_hoOְHH My 2W:l++B[}oϫo5RSiԱ:V[QZڑN_&k3]{C+AEb u.hYU $S@'aK滫GWy3xOwZAֹqU;VC+߸W1:i%D4*a`80#t"iJ0*p$= !\& T)_=utuU* yh 2@EBFl/<*E x&t+TQ5>b}x:/}}^V!&' nPY C$)Y*$v h>z Cuh)Mԓ1'x~EMqC #;ъ!Y9ގy1 !X$_Q f૱y> 5L,Z8!B-J c]&q{`-NA ;:ԉyZb)W$ :(&zлnsu}^(٘/ E͛d a=Tp) :PBtXVR. ˴(lԹ&#z56=}q2W /++OQ3nG(D^Uǂ;T1CV:sHxź[Qo7G`EV DYAVkBaV- x+vq^Q)^~YyLʾ 8)@Qd.$\| q6SegcĈ&*H,"dR M s0_:.^88!! #H$u(5#vsvNa P48u;$ ˾Is]ԢN8\/;A1O)ˠ3)>PX"reBGT,_7|+\/SSl'~o= ("?oE*"7McrWݒ2 ebx<51wV\BGK;pe);*-eЪ^& ?iU[ >L}y[i`" (cjLPg_hhY%\̋+/Q]*EqXLL+= BpaUƛ*e{߉0_|[U?kŘA/Sbf,) R(RTU H,JhZ+=<#eQ>EBQTrPv]CqX|w6 E틗B=IR)fnfxHI 3|E%JtRåy=1,u' {! Ș4 iD&W/sڜc5ܽ[H"YP^fѲ~29ngCCyQͦ<sPfNҊ-uݼ&wܑ4p5#BUJ|- (e˩ C%&0æoi4akJ Xg"TSƕ{ EA"yȀWmZ)__yv6?OUmǁ,vwZW)Q6ѻnZrW]4th04h Dwn1,ymec-JQ& f*ހ-*r9Dn221%*vUd5F?aLQb+;^Ɵyȩ-~-9;g-4pӫ{=ǐ(]})IkK$;9viK}$=ޖي9}(~[lVU}U եTG@ҫcmGL@s"H0 F%kGFM5Zf1q65#1,EȠoΘUiZ+W ςc8G/A(d40zht[S YЋ+IUSZr=?"V?XӾaf6'Y9Sm~" 8X">*nTIIL[]JKfl?d]xl>L@C9wnh߯s"#(D\b0VOI`wS}xmt?}A:[HCᧀm,a9`?b;7-<'Bj90.k{-4F\D0*-Cr4{El"O@ӊIOy9o DqD %L .t+CښO0Aĵ=d(xki<ȣ|ƯxS|~Sj[0CߊUUdzj>l.<<.IZIlYŖs*2 j[n^E$8'^H>-镅yUıƓͬ/}3Y`Jk88 AXP1Bzꄡ2)5ҋjq ӯF-Nטd}F g3EϗLH/Q E[ʿj{P>>=8lƛiJ|ق9%BT*==@|<¬ VB†?yύroqg-^s\^_q@@Arpk^S_#HC0\W#F{f%c]Ф_JD\_hg~gvfѝP "l'{n}Wo9:pixrM|{PV;a :~#'/8zȉyC?|y-{4S*۱0(#Z7 K >bZi8 !jN#+qAA?tRB3%4_82:yn&gW+p7T9xRvg_zIǏD:BI$D"W-9o.,$#QqMrv_7OiM`Z{W ߱_WI" siGw&|ĪJjP:<^/"gP^ ׊@@8Cs*ى8A$# ta coP Pm\vto5 Z3LzArطֵGw)bv O7wlge!mzi _92l6@' A+pb%@ve ^Ӕu^"d! a=ic:f>SulJ~[Y"='euID sKH˟"VŌ^ CS dmN^c!GV5(hG-Ei?ܬ\I\N=zpӋn{&$P@QQ>/d8?O_Av.Qᵷki~{~%ATJ`5ܪ R(tg'}D,ooţFo)/FÀ tOc7i?淸dH=G<(+'Ud%>AI:j>_.y]a}G}{*AJzn1 ihET( ٔ Ade͝x*Yn4z7EoNE qG %OԐU/햖r] $"SC ,B4Y ,hrtzUO3`Um zD{F ]Tn)=@#^{RDn، ńH%klyv l`7DNeqvb!'B|Ak;]5wEZr4bC5hv|he""چ rnȆA{(vTjE 1Ω fɂQG_쾗9 ^’8vTQBm Tz[: E{>7[\hv_(`VN\L+5MzJ#]e1$<9MfWf_xn\בS<ޠT,"'AI$~zC~GjZ4|l;㔜weFiBI"XK"YFȨjU&$UIkasg-AKm}֎?VND],NIB\ $%10>F~>l%kfwL.eFJa~FFj;2"b5_tL}y4@vh֘JJ *qTٯl}ƤP$ms!<;]v@lz(ה߲F 2Tv!! ΄*4_[Ee{ j,A*uWnNlW=j7=Ȼӑ;6vZ:Np6dzRN ovg5=wWyp^o)>Eο|Ӗ[l;cIBUуG.  Iʭoc{F?Y#|WbU[kcb"aĎ"e0\\^vTy4]ɭvKM28Os/p[ƨ6??_ |@7P}{` pf͈y(T{9֤!}l,yvfB:O׬hjKdbU:C5pl|5s8!+(oJ-p~m0j*-)]?ˌ5T_]8CNkNB.Oi!1Sh}*b-#ދޓaStRdňZ7mD/Z-g̕ $NfN&h'm愕YvUVKJӡ.t0qSX%Jk$e|7M_Ap==\eU,P)kPhE-Ez{(Yb"-0RTaM(;TbK 0L .Kip`v?z>{cY$Wqca8Cۍn~]^uhK1g"Sv iGe"H.&" AHdVA@TI.u3xe?GO}m19$Ԥgb?W_m9ݛzuwac{"ǖDDst?7޷xop]ߚu\)~! ypBr;1ufOl۲z\U$^q:^c͗[V3ٯIO=c9w RS(,2_xER QYkZ,2)JĪCJW^e#z ;~p} xPI<M 5ڷPfݿ=Yf<> :X6m|89=

q6}?{<|EX "ȢŃ U(@u9ڜ}ŸN: \ݶ}f 8>KT8laB8dٙVFsnB><""E޽(M.NDsw%RJI { yoe~Rn$$@%-{ v?PA Z5f К9IQ@|y2;cn HPo|r#,Y!C!!E b4p<* 6oGj%Q2aRO\LJM.;;N"8\6rJ%ȂTAQDMX1^x$d} JDѢUėI.~e{A ɳp}]l36/ME<>IbDKG轞|voaZ$]XEx(A 5Aɫ#ĄB} Dn5;Dyr&=Ε*Z s[UݎveJ6&~Ko6>Mq"-v}MS%K[~|ȨyN+v}FQ݁iZiX3>^)-Cl+r,)/wEaKWcc3nskFIk:%v8ŗI=\Oͧ4544ęWiIs"FHG<9rɉ'"a @40ѨPP&h WSHbut+7y1%5@LrR2!*&]!1eēb:eOhHonST Xe;`G'@<8M&*lM$ Sb}!7f,F9]OI%O@OrbVq0k\af׵;喥uDKR- nnT]}J3_W7d'a0&­`򘘾L’T/xAs¿#/7N"\Dsbq t weq}fc2B=՟~5h0*"0Yqrk{ HhBD#,C 2XIt X I8z |~]&Cm|̍>6Pvq '=ࣲw'xyjN Ga:7ۙNݞs|dk͞c𣑎v)6a6,-y$sw;@nf{o*af[㿐xF50w?_G y/X9ymάL c;N;Mςqܞy9(0tčtl85tIsFJk\Vgu&j!;E*?=`/d=tTPG_cXNhIq;qt?Q>C:/lCUR(-F7RuY‚-Q!f3M𰣌ݗuRpC]w *JbfP]7ښm<* ȐEzgn|1oN I X cY_. ]Ɔ7 5*4wAiv|-{VeRJ79R5Bnz:K~L3  ލԝf"?y9%pmFy[dXLqn~7rѿ8kײ^miR]triTqTNkWh^8~^͛87#Qg>~6kZOSAA3'cPĜvDYٰ2`m}b<Ґ"-\u.u zWti6Kyӣ(d[GD !34(.i-ܪ;?m'|ܬaA[i\K Q@G n /BVSEͦVdEr9"m{,} oT b 아[%DV2xa90.d US:#HK_F~.^U4J4~ QlĂqCY`>}MA D od r&l<:޾[˛lɓnk*Ͷ:H1h`/rDфnW_KCdvVn/ bJX@HZ׌6mM+%N/xVڍ~8]V-Wv'KG{]&fJWg1gl{KT[Rj%F%w|QN09펄Hzl`WVK& aiX"N 0 @Tɜ*6H (J%dJ dT2/V}T]\8YZBnqU(@9TFJ5=HÈ,zJJr%ib8gs@$ō2TB`=3L0 4I>3,s&Xf.3OPU|O3bA)//ҺO)H a@o)4Ž=;K?Mic;lSҎdg_S"y,KkiOe~w7Z;ïr7[=ex:O{)Bֻm}xP - `v@ 1ʎQ,1GySr'8mjj-뫩-m/IT&+z Zʰ~-ؒUu${ +f :Hc[zOh@zkA攖GAo'o?әUOTY1ˆp*@S:lW+eZU 6^ ދ;"`Ȗ T!PdId.ǹ*s??`f;)J=Px))Ag |jpyBHߕ $a:9 JH䗎@y3Hejq 礪Z D )X_"@Rb})Ed׊ .,_; s$J>'?,ˤ4y57@̙kN~g_:wgo܋z U%J6+HhpԴ:>C 8Eq%0]ƀǗ>?x`E|x#@BTퟥoi)T"ǩ~)Lw=Wz>+yv65nN<{ t0L˸Tg\vcX3 B{G 3}D-Cn( ~mv+ +r,\r`3V#h-\kpe;W78tD|)w+o~g鑿/4|浼kbWHSL٨.+W0(|>Z}:S)RRLy pޮ&̾P1 `-~w}![Ox&Ϙv˚C@G6(G DF}KPDЁ"$MfP$&i$w%0iև~tUi X(BDn)Z^mD7Β1Zm2(,['Y N?UY\}\2!|dʉTcK9b dLKC~Xg3Tb*m4$Ye'D@QL aQ A@1s%B_h6)%6BXr-5)P%D"S,UX.Cҡ@I5{6aO8FhԨ! #?E{RbL#>Aeo>;*zJ6X_er9=CoǴB!5*T_b5.Mp)\ÈNxS)C'N+1YQM}68v$ B g˴nþdiߛ{e:yӱLujT_Z| (#-xF HK)y+OR{;6oyW|T )ƕ"\O;]Ga]ѿrh^zY.P5![H6Pn ]v\fc4~Yrz+ sFB [fGu* FLH2:- L7B$i2$B q roڼ9aeg20HzmdM!dq@#T:JCvvno#pvRE,\~Y ;ANB},g"g7wQztm# ^w3Wn}$=@ @W@ٴ5&N6/WG*J2Z\sL==~G+ɀ9y5dS|&enh< .yP((>KkMozʞc*vAtQ{Q}O^Ys/ç:{\|@&?ka]K*>/-d z*f^T7I/im=,u)Py6-mfWSDȠ_rlIIq,:>#s "mMb[`9 uFFT\cEw%>*o-ÍT؊oG(J8Z:O3MEPo58L_cc}NVuH6f=y?cg?i}u< eUr539%3mp:D{Y n+݁z w7Im7Oy'=^] 3o}jk{c}F<~^0*?{%Axȍ Tx1X G$,1,k4\7hFM9:g{A* ۪ Q( $Ώ﻾oxl4^]©i)Tӊڵ@޿3ݽ{M}'6بITf@.i&G΄>ueUݞKDRe㲧K [/!@ xF]GLGF'{|Ѡ\럾fBKb vYկNU+~8DXR-󋖨=_w'H}DG_v_Qw s1vI:uc⠕շnz j֬T#? N[yel ;&yg.Ƌ9 q>!\Us'^ rnȋ%-Z/yNo@rؠ*m vTF(W%wT T2`XEUJ0i %Pn*[5V4gbF0XJ)K!I {% Js$3[=|:^泟k\X__Fk[qPJBJ5!VCeY9R9T)cE<[Z#KF~,%޴42*8`SX LEtϬg T ݯ>!JԣX֫M攮ZjQdU"fHUV A[L˅.W^diУ&PqkFLF+Ӣ-C0IbBI⤘0 0 +7W 0qNX9D̗GQ2d,?YɇYlohII$Tԛ %Sˮ|r{ 0 aKR<LL',3W&v<.侷+cov֌7sjoRf>Q@ %| vZ}Uq2 IZÉHV)\"5;JPi_wްf ݿ}`P1C&P2QtEAYoV8A=/qRYqfxQ!P9ةPm@d]DIa1aiΌX_lRñfMS,bbt!(kD(p糶ne(t^ufv{;56!qr_nLDvyN> #O^OB" /hvQU^cւվ*3=,AZ-@}iVs0^jaZ$6YK'z̭Dq9TUFU&ffXԅMC!1|OzfgZ 0UHoapJ?b?-YXb*S IFU)M%k9Q`!xeǔuc~ <@`q/ph{ل!%J".N 3md5Í-s_\>/>13g{A8@2%S2NQ}x3^e;i;BǨ/x:X?Cuk7W1>D:Kau^YyJyۘZֿߓc\=.Qw؋Nr֥ҡ9izX|(%'yWOåsԋ,ٿgڡvu~sѴ~î2|{թfaW=It(}|;o?ݟys'_$nBaapOgc']LK;0BFndh)@Y<@H~]ӯa&jxkߢ"0H3hlߗ'c5+IN*sYoIs5 Y%6\OGW=3W;tq{ *(!0ςoAmH8 7ŭШG^h1/_V]!ݧ0 B՚@N4p;n(/B_:"G'ۚ3LutXrNؗ>aY&ne'@ ?|KX!3kH; '\NvО^"DSc|bϣ;nqVnE d٩X5T=VKyFcjt . k^cJ Ip;PPue9%rYmP.fDe<PHrdV؛v3&rsGs Ap<,'eh_=|[,])AR} ޠu*~0%>ŐLoS)c^sYUv'izqR0LI)A.AQ7]yz'ʤf,:g/MOHgIG1D.)4`}ޮ^?}-|Y4H-sU4td'-QÄ#-IC-&[cҨx#iN6MmbF  ^s? Zߟ-̕fAYʉRnWj :A$θm|g8KF۵#ROc=`n? Z$ȸ>y x4F8lO=m^ͥ֙(v+y,_/yx峉YS~m ;1g=&V =p{_[9A4QlţyRq'+ggrX3]d;0"B8ͤ D0e=vfeH/%-V?S ep>58 KToje`xdW~e\lع2 6;׵f )'F׵"ĪntZZ8*R7,6xbwc&?HY2HouԶ3ua@"Iԁ.5k}lY^+JQ@zOc,z;ׄlV.* 5CԻ"0$aE؁庻N͎)6dh=yogK B4/9MvjmaFv}\=f~7XRLjP &I I(!/]H!i2;P8슿k?TSՔ0 'Q+e YwݰF[)fz07^ Q}'8 $uW(}Iՠ~d3"2F3sq?/C Ӏk`dEFi23E)0  HSލ%| D|+$A_^&Y2mH}u[2ҋDJ+:e ,Q GBkK0.,mbc\h)7 XFt96֋Td`W] 'W.ڜ!!0j!\.8+c<H(&5~8 h"d`ͺ?5َ<ƭXf%̽|"TjzkI^>oI`Rh21JmbBjHB>S %co0D2nzcM ZxɤNȕ&IY!֤6O.JN ݁RFn+jcA6g=wS:jYU?VkKw=`YqUuX!E#/ܳ=XSQX\aB'$_{R"B "RDbn/UZr=Ϗ{ghx(U 1):9IXPK7-+9nBȟ{oQQQ8.)kpD+sjz,_7~ޙ۳󞕅v$ё caHyP(m arLx D9 Kc l#?,<#B=W"n ُ_+)z?|ȷ6ḧ⇐G?vn_m|T+TxSLU8:n`䮵n/u5M밟vq8lJ9 MSҔ8|%5'w&P ~R;uWxn$}th8^cƔnA lÂ:gEkGoMӐT!ָu70JQu|~µ,+h`hv=u7=װ9& U-cތhcwڎwwymaRU< hͿFעve6mG{!aaVl3['vo; %1= Ƽzki!d^kku֚F5;E[n2QV)ނ 5C#H>G#k}M(h 'a-^e6]^e_qf7w=]!*SBZ(_qi*n~ߡc_(*Qrux. BDCP቉z">~~tT+yje K2j!bvD L|/y~/6//o,&"ICc\>LbX8a}+$Oh7_ET:1YIiwIAJ) yWeCfV|$* ࠸CKTڠa2Ji?nZ".$^!@L*ףxɶjtRga1_C(dXЎ3^Hp=&th`,au&=LePW< p*UɘETq&ޚi2 ôtMB*km.}Y,㇆L@tܠ>-B^p w33G4D+.,(2]9Z?- 1` `ZYbc@@*"TN~=OG|9Pv39Ivs ʢQp8.pD6uL5L(`u>vٽVV1 R. G18/R,Jҥ󽍽E~50kE(KqJ:8, $Ֆ9׺dNk'9Y8.1yEՈYy)ιxJ PҞ!;L"ތ^7-'bpG0[ B3ȿgU :)YAGa:G{SuY}:8[1d2D\.|O |",Eb { \("y۾1U&mjncX2dTDGF ȟIŅ%E;=tрD,F}ERn/:3E5a,H@-(GF|QKGķ)!1iW~%$GtU qt \Cy:~5y 8xq6/t/yN[D\EQ#=6qۚYO$</3 Xy Uк=k'%ڭ8OÙO!Y_g`ѐ!֬#v 0C)JR`C`T- qϭn9U/#[ j1?(Hj8>+%K@qÕ޹y& dFEb,tDPYTAF1QQUZ)Qb+ - kE1aY UDTDUX(} U|6ȒG0DTDaXb* ," hgMj(cyXEUº͔TX,@Hנ+[iAF#M-!p@/AA!j aRV B ( JIE&dnЩ @X,`XPXTl"TF,X:- EP`#$XAHE& DH T`dIOai$)DbA@D "_2(5Q weEvID EMg]/1,Q"J5u-xBB ޶NX3$Bb?^lK)qcԜvm~.1u 3 9[kWg@f! o];uX!` "*Q{!kXDעEQfH2ˢ7U\)T+F vh5숪"0ŴPddc~?}=c$DaI>`I$ThRI"758UȊ[vX QA$AQAIO`)V*H b2 XŐ B,!J*b#EbY]qRQE" HTTU#AAEn_Z!ddHREEY )$Y NЋ1PD$,D `$ڠ "HQ#"d ŀR ͚ ]BR@%H ,@A@ F@$X JH"00U *($` B!|=`ID"1Qb bB,)qʌB  ֈ^8 ?qDϕ-P "8v߁53 kxHKv7DhvƬ \ƾ n._7mu.0 "hfݱcve"Ho^Q6j[z{"°-tse!̘pY|OgȐ0bW21.8X<^+j5ݬ;JٜQ"qVeK=Z&n6 {?K Vu׫~L5b.&AQNJgdX\Α׻m ʄMުE0CUZ6v_xkJm:JUgQi@=oV7DL\=/'H\7~Nުw qSޞ^O^_di8\ʲ\!`k\ICm>[*uph̕γ{X7g+"cJ%W>\gT1C(Qh?a~ *2o?# 6'<G^9#:h+ċZ~UKTI qTA&)MfTqpEAf <+~mRaC>cI:ޢVd/[H0z*x].7ϣOaD8„cp76"kKǡ{a71Pka{m cVͤYn*y!)8k+&o9D Db!;X;k`3dʱLK"ʪQF(ER E0YV(+bŊ +#H3U.n4iLV? 6D`d%Ĺ[ ӧZaȰZ1WغRt_mn.AA!ЖcF_2AM!`fJLS;<7FUEsF̀!#i9JrHgIq.>!sޮFSx&UUF|̬炰/Z Zr?Eppj?fW'vZR:"]R3Q+ð.rBtq,91پt8v׼ ŋa!,Zi`˒zI$,@QdAUR `V朱Z^]")K-`={@m˶ml[ `-獉.k/ ~.{%آB'eʎ-0|xZtCiEC Iv~cF Lzl4a!&|op\`8ѷ2~=Ѳ*AlճtX)QydE݈{:kAۣ&C/f^xI WpȖVlaog |O tT ڀ.$A!nztT^(UpW \:eϩnLgꭅK!|IXQ1Ih¬p4`%"IB,6q ";!9w]ߪ6B#Aiҕ`ӼfCiHKF WBU2 )@zyy_4/ފFmM~ rE!a ;5C?´xd2%V:rscZ^+ܠ7`J>L^V!ϤFTTYhBZ8Fa'VDbȣOIrF1\2hH ғ{2Wx~IjL.&x@ 9"1LvtslDJ&9"X׵ǵZhu| e0;i+>ɜ0>^WM\M^$DQ0d]W$qi?܌Y&uDžs2Ւquh+~]R23莦n{$\A$M+42߭nX>Wti',sGjXZFV 3υHfTK)lq&j)0,$H, (!Bּ]gbR>BHDU@Fc)Kk%7i!- ơI*" _ U,!LINSS@#-ݎ-~7Ǘ`\ Y19N`fi@k?9^E炢YJ KXm70p-d^@7Vye2%]GV=չ36ORPFt6͞}Y2􀰸(OߺbV 7#Kb﹵%yoT}9Z2V.,Us۔$_SGМ6R (TDoU/ZtPx*0PbQYж8㮷U ~Ν&tOR^~]4ڇA:1;:yW4) (R ΁qc P3ś $xFt]hdfG6%rG 8 AvU)?[QRTh=}U3t,̺ PXX DR(0XD6 IC>d!9A2ۤZVZ% Rő@&I$#@[Yb{W!9;mn@mazePb,m f,OHiNoCim!#| -AD0nq. {8 C1yyՕA a`45YcnxHvԎ,`'l{FT3YM:--Դq瞡u]=:Uw?\V?6x:# [ '0e}lV yc:-Rڟb7^CMOOҵ&+%tpĪYF{$4)Pԑ>֩EGfڴO9'gz Ϟ]#pO'զ7ʛK`%`OOV?|9A-d4BQib)ˠC+! =!J "b$u~5]nX鴈wWkڼó#8n? UOUz[w!dr HF& ă痶Ye[Tϯ3k+F*a\Lx [_#U0Ra}^r7'E$Cl,,Z b107TAi^yP:}panZWţf*͏qb(R 8nw9K\6Qx!o^ F~!ĺu 7*NImՐ b LN; [Z^'{ H ~e Mʄ]-LjK$FZWG6~T8M%$CI3.a3Qu]7?Y&US_Sk[3sa m[ qLd4LxݪkK,Qa>ky_k8@ K8p<.1D­2To |hpMB!A]ɻ]J`ݴ1^!n\ړ]kp/|+wYiۧ%#=E,`ݵ>͕?h?A|bv)qӐ 2f.U@v}+ޞ”Y ܲRNrɘZ)c2.}Xm<oM1vsȠ"wyζ 9ePZ]1W,2L`yiƬM5h36MLS\ـn(c'·uʱb߷i4Tgǿ6wkj8.2+^.o FO*P^Ő !ٴPkak @$]rw˃YY}BDSb~EBk"싶 n,jq- 'Qg4I  =rFVk) ;#z`n E*#b> ,B3}8Co q^u  \]}4,]sT+eWlR῔R(A6e1r};{sc34 rZ\Z8~X3YS )ub7 9s7 Ч>]ƒaiSgM!J=$?lkIfzJ~#>!8ezp. C !^6h;~3ȉN䳽$ӥP}}Oh";n;.?/L\8/vPV#EueF˛n,lJb)UswGoy>3w?4JIժ=%P*qN$m/S^98䢂~BZ'[/L#e8!Fz_;҅Q1*ʳ0jr4\ *Fw^[H#C1w%ቛ`*QSǶ<}EV|[xn> RI @1e! 3iS},*;9XgtO6 v^\ׂ>..5mYֽfcBrG x$G#7;="jal$9 aÏ`NsuwNpD&\g2؃p R / cfRKr08 65|(LWsnbka>xE߳q(͍#Oo?n΍d! *}^ Rok$;a=?8g 7woqwN??g[̹8N5?VwXב\Q/|~ yQb"y?>kΦ)ҟw(AwC5B $XkGJZ+:$O=op=6qhԗ ~wXkoԬ?{Z"KDzsbs Ԥ`B(FZ Rȗ.G 9CP&Qlz1Y&(>=>L 7-zScޫ%+v񟝧M% ǔFD6~owqnM ı;#C"x8\Ԯ(͢ Piotrǔ:̭hHy#ԶƐpNi⽑o?ƒ;~bǢrrvHBXuvoSM6O`A4es\tf~jL>*uwEX"F+Qw|* ;>W܋5g54z^)@>O9o$3Ws`ogP | Ņ;. 3Ʊ TQ|oZGs]XJi3K;ogsStWL`eygl*7ݦnwu~I=oWޮ87m/tCv>^'>}A8Pۄ"}obZzJ-ok{aaRu&j.\p$ɗ}?0 >c[i'z$&Rbh1)s{_kB_r]{8rnj`dЧAG`:㫭ߟJ/d.%(boxZ۠C.&.*oUAbQ%;T-l6u~9CM<Ȓ<6},kYTcnʯڽ~GozPG>ƲˆI"F B YYe1u`fjh;|`t:4ڕ_Wnh*œI?wSCgk%](wpܜqONy ąS,ݴǂ)VdvGo~2ZN"|¬xA8Ǒg Ҵ,†f{yBb,\2c;:}E09]vX9١{oft5:OO;̫ &-{ﲂUNPƠB#iBRj=}j !,-d4'+^;7I%!IFAKfDNu,n4J#(gi6P9'k!L_>2a4ci1uN~vx9 dP9Ndè#D2uF؆ehyY Cɀ7X@Hht#bq>]e-r\GNZLf4QhNX(v!+rq2ax.q S7 &A`\QL qԘ+ߌזm  FĠ`'qrwIA н@#b#wV+Ŏ2~EB&HBt$.^=w=88WCi"(q=%5 Xnk׾ƍCxǖf˧x̨i@GёCc6p&+^YR (BNoYaKch⓸=C 斛c9bTNĿ@>h&o/J}d!sց[-u(TmAR'}0C9/:^Mf^gvkOT4~#@1A""0/,TTմFUң\WŒC U>~V.~5e( `a{h<%!6J9Ƭ66sT!inw=ܗOtmGu?< ElY H"OS]{m>{yW_e|i wґa8|Ϊ o{Gp/K Lݵ[餆;Z:5|*m{8bw7{/ U}6 :FCUċW9@mVRmO}( - @ 2q,IUxYg|nS{z' "5294q{ަUCA{{ Q]1g$|x G5FP!ٳ7>τ+:_uK*Г lDU7ZzMtcmxÀJBJYn=})])f nc99iRoV@6uո:s}XmKCDGɖJL`-jb"Tt͗G_š*ևгQTbTul'*Cgc3[~˟'ac8f~ O$`R+A67n;v@RXC|#'Xjqe7D"{L]2mNߤA06:)Cmք͐Cfڿmҫ~M=ܓ.2]L%30cQ {If"@..#HDx 9}Y^3@:wF~p˥4=ؼG=6^w,$`@_vElHJx$^P6&;49%ӂӝ_UU9p 3Bi3 G'o=)BMN@|OzVvSLL;;O+h,?׬&tf\]*k5'qDu{@Eʦ4##͙eqC&Gw.Y_*ORI)>qT%96%0Hd}e!ǂ`$-p#"Mjk9F!@e,E)$s kw0{F<s>E782>t5 &6^(AGÏY.NA9ErKoX@x!G7,NsRUcS) 6ߨ^aҷi[l|g]]1 *=]>y}]#s7T0Xa(+bG.+~w̺US` MI8y=$`YmCktOeGo2hw.n!r XA"3CCz46 Dlf);K*x6ɪ#r|{ CV=>1ART9'\;Yu{V ]#c uOĆulT!:0Efr<_LI x9hN*]"Y;Dl(B#g]A#]4!N^pD"Q ‡ (|; `ZYd(,u/16RS%Ta6gz^t5_g PY!fqv&>[_XXDGW\/F "ŷ|ddh!ĥa^ixa՛h9zğz  CHy-=w4lKNwc8:o0#R+ H>h'`sBur}8Z)Z҂ ,Çե'u鼏4NlAbcmi/˜h)_%30 ƨXmgLzۘb[GN pugT)V|ry/ B;tחN<;9$ Œ♵f,g>«⎈}2'[ӞɥIF%du!d:]H&34 ?%ҬefXg35c@%+ƨ8{ڴDƉvDUe H&$tIbi/V+Br-G'3q!PIY6UPbcљwuvEEU`΁ZˢyzpW9G.B{ w}/ft ? 6[Ym𯅝aо̍LBK@+Q4!8A K_} Rhw/O5rZh\۟{.ppT8V;oI1L"NjŮI/h5,7Any-Ȩ.])4@IIή10rt2˸? =kVڭ"0k;)6*Bܯnxdr~o~zzV&`9\֊+ڎ b֔Wmf^GxKJɜϮO1 i,㋆C\@Ft$t7LҏE=LuFs@B0UB vW4 U9~ӊYJbȉ@.V!;`l_'(:Y\RbG" (zISfR16ip[) A r%߾x;fW1WϳQIrD ' "wP$]_*^?2EɖAjN0x\iMoQDZы"@ љ+o PHP߸qA$IM3!^qEٳ-Sܒe3O)jzk.,#fXJ!2Q[) !7ydUCFh][,uء<}:@,|FwVW'7q072  nǥϟxYpڐ<N` jΊʊ6) 虗 ȟ?tXK}ʴ_\/&$ݟSO!TB""s T0g}†m6G\dHjg A"K(` 렑P'"s#tyR} E=iRQ?UXC@2~>EQD*Ҧyurcr:z~1 ɒsO-yD}W JPSuR횑 hzڦS} q>6'Jh!=<(}ku1.vFQƉ6XLL#N& y͗6?1SX2κ%NR>4)ݯZkKYOXeqe@8u@A)K]B Z'o0T}'B)qhS_y]&#w.BYUcֲcŢ*ҿ@"K 2E+BКŬi'cpPPzPǿWC˨9,mj҈p=CS H WIq{1}?2u 6oޓͣ\CRf/. 6y~w7}{xklva"( (w7XֵQ7XxRZgՀIШ7(}k{./8KT7Oa~)*S_ɸX[cOiC||"UNb. N~ ʘ\بd4p=<Z>ҫnz7q|f\݌횹EEQ<7K-l4 y /,藑-0A+ }y݃<AȗRI%w(Bռ-|oZT1׊C (cH()A`1}MR,TU0V yS3%G&п-KEI޶fҲ] hhETbD@I4*Uq/(r8z},$Pጷ6I,D9uS{LA ++UZPE2HE *1,Z6`ȂD"EHb(1ҥƪ4"F͛ Zn""E*0-EYh* U"(U. )(X( TX(R$Qd"IP,R*bCfk*㿚=-fFT"z) 0l3p#n%%u!M_'̾.jkxRq[j.V[l}\l2Γ,[^x(OQvJ8,8LZz#Od<E4RE-i;YVgBUnarH'&4«8m0fċYYA "d' lo{%\j/Ju?[VM;sƈy]CpC>JsLpF|0Z0XpƟ 0x_#^̼r7֫EeWRhaw}ݫ,V8 0|>92PWҀnjS=DooFwğGJ޻ݸO/R݁K<ޗC3P!zq9 :5OfS5؞Ƞ PX(Ɓ.!$ lCb1:ɐ 7Rw>j6f`FnfaAp|]噖+HFju}s:y~ү ǏEnV]f&4p\mS2ۧ[j]>a.'ʾT I6zNGER 7TgXz잿ov߾tx:[ 9*ܳ:?C H"zdL-(Ջb?>OpK:V=$}m fV}Ox HMxiPZO?׸Y1$^<J-c@!\C垍*˭Ů)$#SL^)͵$4ި5Rg 2ה!/ $>ii|ft㚴$mW!B ge͉̎[gmL"HZE2R|NrS@B]H$yML$6,/g[3V6y6%ŘUB#6qxƒ NVNi]gLceB5\@.$,HSPocoi"i"ȷSAB8^ntPw.sz oKcHDWz&l(Bj֞=\ىyϞHz7x@vއ~^bkvz\8&#~IY K$7>|íbې\Q86쪗r,z,xD̝٭i&iAㇻ*~FY0RV7 Qb(Lk'9G?AIoVpgF  0l jdEa܍(>k蹙3UzD!u ߛ<Ϫ tH&ܧY.?-B VPT C^ 5Nh6WDx^f\QHq#?4]Qp$,Ok밶|m'Yh]!yhO%cN;1]oum|yvOAçѴ{}cܡYV&!v)X04U!ĢGWu֝/~iRuQ @Pu!Xs)+gWn~?cGZ2L *,E ohڥ*^։YcZ*7}V%J2Y:eE#:u. P;S8ӏ4x@a/.r)qUa4P’R[U(Sk5L-bXjUh +`!fZZ*!K#.A E)[!AB^T߸QLHrDeRF̕g6yWn*?RzjQ `nIXKd@H |1wVMz0^%l%נsW+x-ϟdڑ O-v!ۭ8h[菿؝˒Z7,Mv({[1G:횛?<5%~73ٙ)恻gqZrrk4Mi1 l^O\i9T^=3SplX Gj'P& 2)_7ɻFY}^0]EL#D0vt ZӱTN1{#0֋ШrМ.\BC/k/a79y_#A?p~捴0fr%Ȫ鑛iփzDA >;JiP=Q6I _Ccӧ?^0c~T\{vѸ]/x/ޒ'j|/L7M&]}" C {yǛh:)x-yFjWD/f/׊'}TivL#;?!)ivQѶzDEXZ$dixViǹx9@צ~#Vsz|LE@3pSW:!ySsا*HЁ@apoJ[ $leM$AS 6.9{4Xq<.3.@K`RB^[߹~hejN" e%F^X 6n Kg$+qVTSDy}q}UhDf 8~XrhE Nu%IM/쓙>qZޏ[e!T2yj(e*YwybufQO f= Wr/yE̽(PF>孀ִb=7TԃN,Q ~c yNtQ88t!T d=}ϥN` +Tp{=?u=13_΂oB׍45R1&̾gјwǜw*6s&2 I_>5<#Gw5,`0"Q,ZdGf{6v6!%IB^G B³JAWv~d {.(QˆR4 :&)u y(>YIgKdr(#gGV~LM˷ɔN|P%iguuai9$l -ِXϼ#]L4TD[XܟvY;CT9QF7e)и4= Cn' "dSqĺ:!O\ǚ[#p:\9մ7DB:d ?K}(}#b^2Fo}b ,G ƒfb.:)p~ Ew?&*OIG*4"L(EK~C:y%m; !VT:y qps a+j@JZ!D CJ*XHJ=Xl߷p`z;݆h=~Ct9ڝU U2:Ncύ.z/oGl,#FKLW |l?B8MWG3qPw+YW JdyB>tmkM?ZnX)m>2 p Jncc_}s[>d) eUWB|XJGy,ƪisT54ʱWOPߒ(;3=KW|>7Ҭ3l,Gt0t,HYm 8P:ؐG@!xes`HL7򾋞3l-qD̢cTbZƗl KKyu)jxz`|_=(=q{ D@'vcEA#"QEIQA"TRA(H$mTڰ CwɽSL 4Vh?; ,b QdF  Aw`1|b?ML]({X>˱`3l53OB.uDĸ@בpA`y-)"E*("QR1H+0R1U"A`3XZF ILY D E*e*$AsŭNFcyLyY4rfћ?~Sh4D^/ {2͎LUF{nVI/=N71 rB2$`]!^$  RIT%k4k/ VWEɐau=`&e%x\R(1׀GN<ɒH\؂yD%@[ vuQ$6R;oE 3KB$Fv/+ikT`ʹ7p6C0J5: -2IqKvDW1y$ $ *SXѩ;7cI3blwR@Qt׷P6kDB _l}թV1?@!](uDy[.ˎa*\q.Q],xrlO^I0us|:s )A#b oK5S첮HlX8hݻI] %962bKZҟpCxY^!旗>cF=j7ok΋o^M.u^QsZ@q 1PLKiL2","hpA'XoBhN\SJtK.nyF<5~cݱ;QwrDPa|7=P=Yc\s5"˻%MVvinF6_##yEb8XHA9݇5V$CcĀK  +!ӤE=YFT(ZMLwSE^d䉖ܻTmv^H_TX7sn;L!rhKZ~Di<}bV?ͫ-‰ c`V!D3۷\ XV*:x Qh9hՂ2NKWxe($oQFJ(/ǭ1a=Y+EO e6['_Iewby6 =lbCqnd*ɠY!9=76BIQA8Ҋ/w,נ=Q#:WhWT o ( !|}\8[Ldp%ieQz}A"Ovx'/^ATxszf`xwxi,zB>mX7zMA yfRoȡ!lUEs먒 zl\\&|Tqo @)1kM5% HQˣq\ӓ -NԬ*W5wC=#эhYbv2y 摻cJZ*?nnVk[.xEq=e5*ڲj}+I/yѻY_XhG JRU/S+e=*o1C4@4QCݶ;o:;$6}}YlMJ7'QE ؽLJzzqDJ (9Bވ 81l;һucN6FUwGW96Qq$_Z<,i\_yŪqFNC;67@i8y{[ HO`P"YF %YH\^uе&6HFn!{-2m=uĠ(jea36? 4k5IC~Gv;'%tq\|D&b2I+k6[{;)ě<M VrcڔggĜ@X!D8e#qpOU“Iu`]y5cL3 cO}cW3g'|v:GOF{Tb Wngw=sT 2L58 % @ '=cnZFhr\dN/H! X<|֋Y{d%3a(2" |x DcUgM_O8[گ)~W!BQem< cPO8F |(cFN䢓v!xLD r|Zw-w{Q~(&ѷ審e&gvAU&tlY84cimbCׇvqAO@G|'A/)k?~*Q7{3m/QiV9X݇_5xz>=6>c=U{x˔.Lh_u Џ-tgT dCyT[wZ?-+_׶z-PјƵAUa2rLFų)-SL(~|i- z_~Ǽla%o)]N`QB(]b&mA#,{#.@/בTA RҔ.hJtA_9:E{ZX%qGeX.HĚǗ.7o]$˦M?vXPk8$-!Ϊxd\-@XoL1{٘Qe.2eT.nXvD8{}\W@眵6tm ¢{eD?W|S=#@qnH$Y,[aO/~Y_7\>m$X@sNʾE6NK~xؠ7ez΅>,X9|OaX6h>F!ػ Oh~ȦT}AppJyKwtvN>mHo=,H$c 2*6g W)kz/yҰ0&hr8fyxN[#3 h,q3J>#zvz'.B;Լ4vp|{\r/izkO[yyPe=TkQy4_ :EP݂C՛Gg#2iSwӓEn5MdUy2 ni*OǓ,[Aħ0䕢y<(cp؞z;>Ue[*(D e7 RS m  !'z?,];BNt}NN%EKeVZc=jROٱS;S/3{HAtEL&HC.eseLpBH$nc"W@<XB=V}3"e{ZO*> eb #-.15&)+GD`w^5yk(o\pG!,R{d#O@}bGMM ݜRq&`g߹GфT4n:9\û.Ӿz3MEM܄Yΰng$=ߙzo<*x?F !*_\maDSDDHՏT/1ų#> P+.P8>&3xɞ@RGeTUPO]U~P,몺-0 E`BTUS& c Ul?㸕$=4q:kry!f{QՖ[5 7%eDgPc~mJwgEy2/^ρՋf??/ }Gj0>{d*<)(=3anR$y>Ss^ۣb_ͯl1rmO[ ;/ rKE+9)gεw݇88_M,r6"i\b"9ߒvw;~ n "TQ`g7uF~Y+<"@ETC شx-Toң$ט'#1lήZ<-k +ty{tpB+[ݷAb<ޏƄ`Bq>8Q_s:᧙A+$=We-k0}q*ϯ% 9Ca@ch*=D .tUkP PJN++Rf@,-n^03N,ȳp]"[IF"]TxeYGAUaJd"ÎWKbnѪ*8lu6|&2\ˏ}h gQ1}U[}Wzؾb_bEmc#c5 iᨇH#HZg=,Рdj*oIӜcebIQw.3a+H4}_,{&tƗn`d,0 i3ll :kڤ([///,Z'FjQJ>.ђ\kJ^MmfAsq*zzcޯ&c,EV'? iDt 9y?_7=W՟V4?}vnS <>y2 ]%u5 fé.:b9_hYb::hjđeYy#N{1Иc('~{ ͚ x=Ɇ܎݀!4t~87ݫ\v#ւm|ϫ_p'ծ`%up.z]4h) 6ex"n,te<%=蝔9Aj]璬R!\bg1i2:9]SMpCRoe2q ) W5LBvvM\]f:|?n]n!3>W Wg3ͲJ3n|<+#,mb1YGVE@!D`pi#ru Ix:iMʔ247I-;(mA:e &\F'M_A*@K0 gձtAEFng[(<05Qe2uqwVY̊(dXׇ6!2WnԵBiUlUASc#B+`X#b0[ Zf*b–wXaw+g=8HAB >Ll]qUR7P&b!)6)n  APRNf+fŁEA#"" AEt' 6еMYeUY2$P*+`1QAF 1|R$V QX" JQqT$VTOtMG-ѿ)InZ #81M,*lFz@7m ;cSG Yt,2~d0?I[೪@d%+lO0~ \ XpPX9 Еw'A~B Lt̙5ebbɯ.1P1J"R9a:JbF[kP)<y"$Q'*8<Pro0QD|4(v~RZ17yʖeURj$K٭eϐОwU:0;CgaBɥ<]4ެ)GWOfl-:6#\2%q2.dSx ѣ’EY9x[Q }=|lAoR5w0^~̓쉨4uf#&wѹִ{PCGZPn3vׯbu2v1Gnd+!+.O809 HN5Di R/It2~;Gɘn/[~r :쀋/n!qNڇau:x8<2a;a3@ܡybJ+ 4>s%%^Uaq!t/>u0C%H~l-<'}|f*MD9 9"ziMd5F'3/e:գGCx4z~R<%_󑷘z6ե}_｜ H-E:r/Oy_ydO\@ߙ@7= ަX뿸B~vZx /$,u$*@2Y)luuZ'ynHHg]Qt= }r0F6>;.P"Yaosϟe`g@÷-M w] &Ĝ[_Z`:?d Qy%걬}"]K@r%*|٣ުED tR!z$ nbSfL@>3ېyyτ㟎OwƜ_uVl憸@wE"X#c!f8.5CU8e=ꆽ:d%`^ՁG1 vqhaW:#9"D(WcA(9}2e^] ʰ| WN"} B`ˆw6؅չK4%@E@ش[>3:`]`ܙcAڳpi803;P"&Aa^ɑXsچUVLl{Q髶p _@͍Z\|Z!& GjMEMWQhgPt-dK-B9,RYQ()*B, Zzdh/R)v&siL!$<Ⱥ] ^tVUq1t?Z&k3Sc(r3 k3đAi.L&`+gZ:  W)`w@g [ԕ XaDZ73V@M#qM 7@LG=pi3w%"jP򪤜iGhad/ ɠAHj2LR PbXuFf10>RCVP(hnYߔL2Xu*JBN <\FnWV#abW Dx m<;I̝?԰8%Ψ[* q3޷b›`*  <4P.rԑ1 dsD@?vQvOv GQJ7ѝ[\Cd s+_ċ'{> &$TS'yWQ-;[wFU +WԦ,A B9}}u~I'Auh)gEɫ#ݹ-'x/slӑ+b[unhC5dD|R{.L؟edwm~+o| G=!Mw41_ŢY `!A 8 :K>!-;Hꁟ&L4꽇y7D{7+>z*/Yw>a|BJv1ޠfًqSO`2ގSe >KӋCsǑsoR K4=7b?nI(w^0@ >sއ+n|腏g!\B'~ 9U7߽+ǷPxCԎ\R=(TTCqDJUJUCv"F| Pq3'4rI_ 1;7ty0 ~lڕ眲(%96R ~,hk>ƂZ:fWEş,5c}wz͈o#/,A4y l.ϮoCCԪ x?@CgOgۮxw;g|n6W˫[)f_&:1ZDCH9nMYZD '*KI_w=A/ ~һG%_Pfzw4O'=m>3Mz@bR[;]v$߽OZA?ڧX]#mXu2wӥ6PyhDS6U=rms_wwd~H6O"N1CA7?͏cC3s4}C яiA`N-o,Ȧ֌&ӇUw k]FtM2wR7]O9pY~ޠBd2Y%-+7+ >=96FP#@V҂p@9)JS$ z.1&`eyW;je<.8 _hYfZ~@uzf,z0z\>-jJ:+eð Y̌C$ץlr:1nYys+8K<9?D;]T8IlOJt(kM`;޿;t M9:%\1ŀ#_""-ƉISj*]b6lA!d!voR&Q[4󲺅P00g+Ac(wΪw׹C,)Q0Ju^lŐk*<tO. [6z,3Z0gаxXLD!䀎I8/=nPy@Wm |9i=+}5 KQ! B{Bz]|]Ա ]*2 VoVNi }+bƗj'@Kw)@(nH^g IlP*$"PB'0>a*J%|`7ޕ8:zZ!?է3ݰ*l]1pMJgc`(L\g(Hvi9 :l*Hɉ$qxQDoxvu*3E>+X"O4~Ǔ_it3^4 =dXeyw7һXG a|  q2Nz38LE" "teTzF?:, OAJyuenz?D;a:^] 7A7m7If`d7uv9/[NaWp>⸼TG QHFI_Wg=5[{#2*&fQWbM$ǨO\?t~w~Slx'F֧=5Ɵ{/2HLF^}XĽL]ẈK*n?ynz{c<^]iVc=+( Rs0GT;bk9 Yf[ut#xmYgj7,y:ldr_~ jɤ9ۆ~BaFAOr?.sн(X(cdXAA@DD v@_-۴Q=_ R?VL#l7q?7j5)7Y>sp_y ĊvѫQ8wX}VcPkmپ8(${iF^=Mw#.L )uvRU{OWyB!OkfY^M#1(hPˠHcK˘k:L>11? a]{o 鎧? (8?"z^Sn r|J)S Q>$WۍAN)IX|@I;QbP07RrT^(bX^v7f@~2Q?c!YX*`" {|,1A`u7uY ZM(/=3<;ԨU8UB@q yƘ 0Rf"0JYQUPYIfdr-6 (ɰ@G #Lʀ]=0F"'/jLB15l)7"G 3['w *? 0Rt=2hc|Gq!jj%E]zzga̹ؓJ{Pޞ.}v`x,m$صI69zV` UT[L}B NӹXc,g&*YTT@ݚHI"AfAv =SvfA4!^L了`mv[Ƚbᢎ~6Á-o9QX&v: "46'j0 YyJ$8ɠt~9fs*,k _\  /.uyJeϫ+QkyOgW:Gj ^&,-ؐE?i&+$E]اޣ ɒh)bğ(}kSM>&}tAIB}9Sv_Pnοo]wV8UBlP_|>qsSJ:*P^wfK?/_9-.ѪmU1XG,8K۞%EՂ B⭆a{p@!@0뽽0?.٫p2)i#qv E>@Ĕk|{n[8A"]#S]֪ }#{6[8hɥ~+}%k>ni ҆8QBmt`}IyB Y޵ ͢h|ܞ{.jSGZRL/xYcDwG!nzg"== qW E Xvsf2^պ6m޳k?2@y,C"_+R3Ɲz.k;qq ĸt9љ|UUL@q"ۚA,G :+R[T7V 9vTD xQ F >źGbi9UAX:2l 6 rxPQn,rD7hIE__^G5GGC󿾮HCXY) &tJ1 uOVzLMR k*1į @f(1ezlůGZsPm i@ٗ_ӃvdopȅT"&g9FPD]^Rm"'Vv77)olmB*k#ȌIC>\,)Hn 1qh/13D֗w‚~ZIA te{ uMl2뾍fUtY[yXՀX#41B-R CRaM,02S N9jHgu5?j0PR)^<`%ux K8@nw3"󃩧u*KſE)47"<+W|SvdOiA`=BFًKLc ٌgf| 4saMsǓe3Ǹא9OpPP^&:o lĈ,-bCgӠ@5 P6YQaCsEZQ:u)ixVmx C]-xeЮ Xao=[~N,u%˜ŐwC7dgd,"\B5Fi`¹1 0|,e.uFv=Ur .ٚYLa͡1ŊzqA- )ykҫ %8d0߭0SPAl7C"4c\#$uؔ&peP;b&L%U% (_C@3fyJFDٌ$S@ [7e$*3YH=⎷~7FۺnV \~_k9Sw,!=$݌*Va68 Nhɲs,!ь$st{Nv8p;ߛzsw+kS)n_P;~TX@t+ um2g)OZ~0D:z@=Ԧq9_bwfI|̬F4Uٻ 뙨q<:l2+>t R+ȩIㆴ2VyL{xS^v? e;9?LC{It+hɥdgalj_S>r>.S|dMx4x3bXnXjހV.P}aE(˕K"a(U`H#'NuX\ɯ?fԋFٚJ.W<MOѮqٯ~ZEOKj>voL,8c l*6 Qa ?۳oswW[s;˵_zo?7›JFVVD_sCL)8?Oow2nͯpG%`X;ʢ΁XoqcUFȈA@rP5PZ,F0ԙs \`r"cAj'(Z 0N:̋Z\SGG:pP, d*{ Qב29sƴGeт*mZ:dE2NKCL|Z+R-b s.3X$6 k8DJ`+Jk;E<?>.. d1e  a"EX*PPV͙PX>QX~> ]n>KyɬDȰPPSf&B,8 /;rY7M3ngC7a=S<$RE*P S)P E AaJIB"J@b iT-{S}Z)&ɳQ_ՋQ\iO~Dm^j97d %AJ2g74ʧ87 Ƒ]Y8@#$w ˕ CSgõ>WџBCC֍RV]B@P /Q))$-|9=Ⴆvc\{@ZS։S4FtC!b91g0崠" NT mivQN ,rSS&jjNl2ڻĆۂ  8GR0v>fg}e{SK׭ў#OӽfEqz;xPKټ4sZ\fS}Ւ pwR#e&wou6˜NSh9/ I@q)1/9AQ h ¢F&bzEtѦ?Lb10Ng2%֧Bɏzտ0P$C -0^S&;.,Envz)E@n(iȖot>q&W!=9CQh#hO\5ouQlOPI8uk2{X 2}{1]qe{ !J_;-Q|9C2ys1 TQn`:k9{gY{t]$:ɦtD• !d+0ъ(t)Ώ޿n5Ksobv\O/P?R Ā puwv)ypbb\ d ~oA̜wc ㅁ~_?& S݌xshC ж.+y'Eoc!ӳeE,Xך\]:YQ sh-'q'7Fk}Mv!l:tr3(@@w. "/?-?]~_ֿ^m?@H !@DiP A$= 9GO+;#]Xhǻ9_#g!;nbxBHϜި\ AnH\8I/.u7y9w ̝D{._foO&͍ L߁@E! ~bIQ@]);(ڝXI ]շ AsO:#86y5smWUQx B &RzW|0 pH`,$`dSe+^F *0CF2B 4:cb%e ǒs9*l`9_q7-"Ian p 5!h^)Nۊ|MlX_[7psFlbA ֞h./|sDq A(K@MTh2׫/)vb*QsnpJ̉.!XL2Q  %MG ط 0 u8۩BkoU!n{;_IWsx( 4z?~LyQ?lZ*w[J/u-ӥ噌~I.}r3!vw{9䖧'a#-ImzU؋{STL,:W'{2^ab}t|Cq06M/ 0ۢ,0HҺ辘/Kw;DggFʡl>0Ѵ`ƃsUO 󴬘 ce}:Ǭj9I,@9K:"0u=: r"v -A6q:V`jSX}a731'o♉txrog`'qC<*b(ַq([dY({[D*Qe,Ꭳ+ϢXGϩi;,+tavs^G|?-U;xIۉڦ(jO!_o?D #œV?5]˧ffkS v}!1q۴!rf{%]92:H >yk9sv-nzy?.)Dt櫸VΥh91םVʾn^GXSmqwr8OnaW[ >Xg A3āᓁH%7k[`/y}zχ=E_}#g;Yt$uV&Uph*|}hKؕV^u "|q FR{/)|śN3F ,# TRJ`EQT"}0+ ((S!)PTHR d$X@DQX HR QEPDTP`,UR, ɒMKSH*}Vw8[qeA`.IH,PPQ`k Ad2( "X AdB,((G R*ȤbȰUH)AaQڣ q 9Cf.ZBro|AN{C.Lńb2܆P.XsXA@EdR) #((PݢXQY$E#"B ,!HR(R(f1RYQHV@~x(s.U618گ\rBy9v~r)4y"$\Yg 4H_f1{71;* a&+xA<4Kk&(43lW"ۡ]""U~! 2UTOwAIѤCp|2떘 :l BN[*SXǦus}[;Z*)8"9ׅS$f2WBs]܇X/"7 c1Y۲ d=7󘛫K=8@D\TOd4CM`& M&Mu6nLg93TL#zdވkQCIV! ȷʃ5;γXiZH$ q8qiI`E6!'du6i~rpߣ^McR33I&dg* ui:a%YK1VC2(T`Prn8oJZPPYU\}i&DL,'ao[o4F e(z ]/:Km&S߭}c|CFh^j`[Gϭ]w; Iv5O$H/1eE>/ cFodw _+}$qjrx X#|w>vʼnWzfOjkM muQ/i(2TYV(=RA$z9>%>wh_ m71~?M=!V{>3'ГJ.E#O=0AnnDWʊ$\zߣ-bxib.SEX/\NK]GDiO<OA;{FЊ{'T:OO/g9g02b@j *edZUʙ=+P}bܩ_xKVv_n vO(*t*eL t38܎gBAg[uoG1n?ß=vwcRG cuh|l_$~jCoB~jH0ʕn)iXdF M&J G!*%iZyMP:88|8 Q@/s$:*?1jC[&['D`lqDVF858tVW4B~Z\F%<7LkQلjqq YCa|aQ^nٳ*$1h*eN N Ͳ[m&[ }=(qGw1?쪴햁IJ) 3q4xQ)ʧ9:2 w0Ef Q%1\a 3<EgT@V_ W@sharhIp $Q`߫ʳ3_N6h @h?jUͲ)¿쥳s`w0%#*ۤ38}Jnuu(M@MV$ bx7G]*y-; SpBfZ+jM3\WqKZHMww}Fߛ@M_9Jn  Ƿ})DљBEr 2<@8\XԈH+N,WuE"nI<^aJԘBk)v7kCmUv%eAʍhL Zj'tx+%-}E% 7"@i 0C(/h9 #1M-({'3^U1r&"*){!Y毥B嫯2kCH]nOYuV,,rɋQV۝𚅐\f6$F P/f|mY(ԂSO|A95ە%E@B8WUOieE,],dzDp6.rd0#\HK'跖'VvSftW>w czOM[T@}`\R\eAH ;!@J,3ݨX ",<_gI!h,J<ӷ^9L" -I߼^)sKi,zwσ=γ$}ҧW=,],<~Rj4- ?bC6oǴhw&!.G$֤TL*y^:m|otgm%xbg1>)2̄yӄ1ܝ?񆾇) iK(dnr[FP'"J96'IT]WJ=QGŀfXY0/1|"!D31L8pwmR̨J=)WN􌸹Ed0z8 g'  (b6H\Db lmq}n|Wv_biNrY'Px ^|&J;Pj8nyqVmʷz+c lY,j:Ft'G1G9T.WyX{[P2a|ɦx{c{+{z{=}jG"PV_Roz6j>>3 3IB@ge-z%OQ[I'C:2yW|5`4M0D(GpH^& _뿛^۾ݲ )LXF%GA2sW"}A` T'4= iTΦYQ:l!ӗ!bK{]m49tZ3 :*~F,xnf3ʬ?NIu Giºs? }79wps~}fI=8Oa8#lL2*,+"h)d﯒~e|am+ 2ЏҾ@]_^<]7xvMX{;%4n: B{g;&K:/lOri)aKtw*5 =+6n8Q|mCϗfLXU6=~ӳfqr5Y6|,$ռ`G츻> 7mlGԶXű?.܇S-hlKy/G%c\Ml剦e2KyݑeԹ%XcŰ= N @Ȼ^м-E믲 veNRѲ,n.VlτF`.[8Ӻg0H&\ESNnmQB( \N*vN^!^Qe~*m3mr8DvduAxy`t0@ٕS.UV偲]!K`˭@L.2G*kaw<62FN,ͺF41͈TJrclѤ)vܬuW p4*/$b>=5cj1=?Y!8#uZ $E9 +:]wYiϛ84_|eޛݎ8.,EI(`,Q;}v0 YEJdRd ]RU\Ҵ2 ~o2OݴN#T6gs0',2Śu ED1zF K܅{U`v3AWf~^՟/ Qy;zOfx4K{$1[I N+Q~_9|8 hTQ Eu1ZZB axÄ#0΀t1* OoiY|b?lOlʥ Bs;^\M!$%iyzx~ ah@h3V%".#A,)HCx+SJ (;ZMI7JqdZb1c d-ZAͮT\5rY0Bd!!cx#nzǑ/sCt b݌r|=I`Qpeؐv|L#Y=0?ɺQQTDv[X]Y{-/հ{z0:̙?gjjes6'M$7 `q5h@B EEU̡AqЎ?k/9,eic=AQ ]N+\XFPT;rx->7X𚙿[}@(qUXAJCTB|3"G*35\0_*U=kXYg'I9G4>NPxT;Dbn~χdwq[{'<]0Uq$N]B?_knfCM\˸b03(z@6mI Gz~owAq{¯A};* nRLDIP**PZus5w֬dE 3n~H4cGEw7:l$0Dn%2-_Sp0|wB Z.Sǂu"|ʘ@?Ĕ'Ag?坣YtwzN!E(RI_#%D־Eh:9Ҡ  )s, "1ƹT?+6õ@5ZwoшI^r- Nj$bYqclVPځ&Z|z@S .{ gۃ: LBA{,?4BxJd|Si*)Zoa6,4tio)ZaW>Eź~vNUSČFGAj(p:Gr?o4& 'Ȥ%e|(`#lF6>rg35mj͉JIs:$?Y𫄈vĤjP)KxX(ɛ(B=΂qDXn#. T~4㕦.>uL%J@9AZ1 Ή]()_}/A"1w8 ʎoܢ2,#0L)T(!v#Z}%TAq{!X?d8S-?eȡ릫-py+M4X-]qBRBMTB*}Oqvc{մ4ɫ3%.k(=,7ٮm1ÎV,ED!oO]!I$ƾK)4~qT 3  %5_)GDU:)dEֿv7s([>ݣ$R/[+gꋢp^A!R6BV_2"4n/4%tH!)ؚ䷪ƁEn%sQmӗ6V0B^FEbO?lxx36WL<HQ7wm6q/l7x؛(Kvt2b;)k$oQʬY  >30S!m#12giQH pfC>ᦔ9lQ2qʯ%<Ҟ߅ОĻRG 6A!cU H]0Pe agtYEgÎIP۰, zJ}EԚe[dc9 z}5š\[iGS~(qkgiYs]_voڴ1 m1% 6nN?f7ۖ egIXށtc̿,nfZzo KIv(ԉ|ݞS֯&h*DVf#_ΆkO7_4umI)_>'F_gEI/Le}8%Z PFzRܽbFȣ߇]Ri 3Y~ |^"gUZH &F>/(jź._'ȼ|V\yzG: oAUA΄uGABu_;nSFo=/.4~@XEިG[AZzBߛQIC'*nePC?2nnybDW@ Q7{-ӛ+kN0F{g噼y6MTIԧwV ~6]Dl7Nk}IDl& Nh/,~GͿŴa̠2 &7)2D(UVp͹pH9dyWwϣ癪HP#O:6[MޯG[0?ŹAwfCuc/tQTqp1{F.mh[rQHs A-?#ѢWtrʼ8^ =ޚa`Y̟P;~:~uVLp"%:d=T9_^WʼӦnpPaT*l2ygx?,9CPNla?$2tYFT'@Efve酟$kl.yIފ+!V;Ja,ɇuČSCz礸1E`d_FAB!,du7m#4;HlSVI!c?*J+y}u+V+:Ҝi DJǷ"vNk^۪'*@:W1|%?x_l.\77ojW83Fq1#4Jkc|M s%0?Sxd_mC@3(o8n¢Y= Yf/?zK pycvI ӋdLzMgsI*UC'LzFE9mLXY''%]#.x>B.dujhA.A|k_[D-$H.O>l+ E8z&K7&wiɵV( HI.a)7I* PQ:c"(["Dz=֮⹒^m/]Bp!Ɇos@788N-" Rcb?ntҸ {j T S>ʔT s!иaQγӰ=NyAdCPq-sI1΢iS)u~qn"G}?jT+0qgɣ2N*YX7v0B )ʀ ]rr,Q;Q;AaN@T\痑.Rt.+jc[XIS*gG!Fv[gSN5;gT%4cg2ӣ߯}Zd TJWG ^޿ܛ_.wTComc~XA!?hAb>|Y޽*zɟ'Ptr~1Īe0PX}6([Nfxz~F%#0ƩV) Hρi4v-ڼH VN0JAĀ"T̞o!hSȚڐCO#6 1]8C!l,v =,?D%I 砲m^ ȳ@ŷ)O^jݿ9]I#tR(!|m-1j8<4/eq9hI]*-Iё aIy4.h [sC{Z1/f0O ))]'"^b(~u?G:kr/8\%TNR=N}]LgAf0ܿo'7CrҍŞ'5R}y P~~ y'Dt j̄?oFɹG_6z~03"xelʺW&\*a:|TcFTK_+9.5$!>h>MBgՠӽ)(p*)]3[v$ȥKGFfG8?0ҝ# <p#v$9vF0 A9(c-f?x 8e wY2Rfk,g@Z?r aoƻ*0lPpq{ zԘcD"3Ssx&tz;1$m0 f#- Y+\eb+°@72QQ}sSU|KEZTP"\RvqU=`d`HVi [AahɧT . "ybFRoˌϐ5o*(>zp3spؽqȋA,пNǺEle&#Os-kv~ϦÑ3@*^. -APUMYZvw =+ɆvwX[-^ ~ nhlw769$GlШyb-Nðu3ufȜRb:ܖRB(Xh]7Zt|7ͱi5X m[YQudw46Qs T%.K*(@:!a3bؾCMPi֎gDzIt0n)O"$Kd*X>w^g::1YOzY:!=Gz/mATJMA=}Zz%2<ڲ.[8Sx&ԫ49#I* Q V` Ki=:>Ut6ͯT] S(YOjTycl62XrEXMԹ),k^xc==qu{lخm1D Ȁ2"p*0'}9JOCirRT˙k뼴Zs%~;.X72eU"`)’PLoDT.kpw1իﵻnۏ.o3Đm${ִɂ[8IǕYR|GǑĘXėsO?l[Oz4ÃwQUz5ڕ2{z6FM"#PR(SqQBn5w+T^36!]y8% P@0E9Rnٜ[aˮ~(xFY榒_iiPx1F^咽 Qu>Np񋽚4mENZM&up(0ӯӍ3+7OH 4'e"m.ZC8e/l 9GVEv tw#Um$۹!=dfa`\~;#mb^V&Ҡz2UiA)#wr+/Qq D1Ҭ݋7|kov6BZznj<ǂNFj9ނ%U&C\X:f}4;cbZ.n5~ #y D͌ߤd>2H)$y)0/`| ]c9 ""lv DuwN32Ѕ\9f!Hʀ-3ZR!P:Y啧BF8o ]7̋`HL PH ,cVn4%,XKx%LC~;in]>cLb5E⛘:Vܧ%I1iO]LG$K6cy!}| h>oR/mɦtӈk)LJ fKp"u} \pBы_ct`* ^KpT9K?_@'߻Gt8.߇W&r9q.$yLc+> D1{s`.u˺Y B msw`lSH)6[5 -cKZz#$NBvIGēU;t$4AP2< ~˴‚FeXA}ܞ)2*b數э.) kykqRP4c+YqLFR)@v^T9;Ie殅Ԯ#?f@X0O\[Y56ȃݔ@>2&b98ڮZըS[J"j 8о2Si3r-S\ēK|6_#i?Fޚx gm5a3ҝY[*hEy) Π=p&>.b-l[:g[Gd] F`LNla]ӡW AKXCB{E'㰦H x0s, RHs5E s\D.\h3h8u29fiC#d e : &vV (K;c?S/Q(MZ]t_^_;)|!lި'J^|p/ k)dʐi=&>>lӑFl 0W0/NY mNz9#FdxntUM QCC>8~ 誩[c$sZ` 틌Qd K[0$DRs6QSL`CT(q? f7.w>&lР)QO, )*"DX%C1Du{J U6O|o%U41GI.8Fw$G%ﮆDR4e+h|$SY cZPL_PYt1$ pߑ}'A+*-QNC%/X$V>fm 045MtkJN|ѵ3 Fy㲄*+ B*@1zPicaiaE8T6G`x6*"($,U"77Κa< ^_im%F:$);t_ʳ7 t${1#.&Ѷmܝ.Op QCϊWI.Д;NPgZ^R'KSW2Ct!7RҢkt!Z_ :ɔ1"hJB2lk$A}s$vA@α-^i _ O"+I^H;h<@D}(R$46(M+ȉqPQEt\ &h̡Q $ -bFX>Ng|wkx>ں cG)6PD'ZMrT7?0B2a>9SYpʊֿ'ݜ JNi"{ BTyLRyOq@:\HѵSMGyD0|n(#w,zՇA'Q TmGHBmÃb;:; Rraأ޳6Na_9`ٖFZUYq9BEJi05m3.跞k(3/GSz}y-¼ԣWZ~VQI N"c28d Z(x!Q6zvtJڈCf磠g9D3W>~W#r2r:5>2[jNn:&81Qu{H0.sхh{2?rVލkk up@/7kWZ|a|$xk]vQh 5zޒ5P^X9|hc|tkIACr$3SQE<3Y]+ NԀ_*ݞP?=0+Hʻ09lH`34hRs[}c8iFI[M|*ⒼxZQ s'Zt0,^2M3b*qN XpBj$G@ ;͖7AKנd팬5d\I,_K,W.%Z~_6R\ds!|'v>7QTXTafOϪ0f \J27ik3h3.h.>5{+U4b@UP (?*yݛ"Jiei$Vh=[aF/E*`rM3Ǘз& s_< b2 f:C?r1ɦYD^d5&s3HyzW=r[#pbO>$d` htI1NXESS}pb*>~G(R[UN`IC&<#E)6Qa;JVW*Jh/O0 z< UyS!=,. /u瀁o=1à''V7m҃&M;nl3W#)ʜhLp1ҢN$/'q$^1P; 0*#;o&V$؆O_ָIS5c, l:>@ծ~[9y/Q#;..)  Xq l#ۤ(ơEƶo'=#Փ*>l6oQDIkyn`?HI_UPg"Qe@Uk,bw/"E*jfA"Tqs[W'|\U(E۽:Z[ &n\\2e7M\j0jRuy%KdCYR^3ݒoSb\9C]} `!ZomU|q@,RP7$HNp B _xzIB:ėϺÿ~W˥',N-8d0,_ς oi8 q^6K<p e)о')좢 w_Ktd;Tzvp#e\+ޮxn tvw*a(0,O鬱Co:F pG:c (\smؖ?!"~Cү:kt=s(YNTAp;iOv&#/jK~ R{.JлG=!5Dͫؓ!ǷٗD8Dpe%gv 3s[+T. ]n;9r[  ޳P/{[[Ou;x 53_*h 5aa F֕`Nv+ w33&J@h%J+%Ek:ꌴB"x<$ҝG“Bg\0BG}LmlXhLig8j}q!.CC10aTE%"0Hg9l!كC mcgkƼ0K"ʴ(1EV9Z|BG^ #Qg1_2%b Pc;C,~Se\82F{D +;`DKL&vJ} 0AMU6LRv >TsH܍ǵ35qhZ`T.A! WzzYipMRi;N) J 482d"%ˌJq65,9 9ܤ㱙,8B2i,4Aq@2w+ ӛ <yXOyo)@x@ܰ5\9-n™s0ߪJӪbt{J!X?ZS)~A |>{˞<d\=8{$8#˜#aqf5l LeDXȒO)3_AFUUl:;TGӄ?EVDL[FNQcgm:-ze}|T@~mIGףM8(M@BPw]巋{^~gɈ7$ ,zt %n}|zCGp Z__ymC`~$sbQi )¿ɏC5mG]p;k>L2>W*H2C5م0n\V pt o4uN6ÚRY'&DȈLqM)cݠu3CU X-y.? pY= "V(l&ȥL~2vF0 ;j$;xn9 Xr48YyCu1(oU~YW"x/fW;9a7:F|:=q[ O) wG7#}Ҏq9DTMqwCXowMW1`Gė9g8>_4-.'t%b!vJKt߯~b Iml$ڭ 7w?meQEWK?܅c\C8Xv8*u^.oMԦ4itjЖU} Hmjh|?=aمKsI.O#J7c@'Gy' 1] Ih2>eޯ]+2ib_z Ra{\.,Lu+ZzW nV5 V%m2'Tv%=ˆb?II/D*FM}Qu@f+.9l|MV~sOZ"Cv+xG ReU]擙/_jHʁuి4|:T,/߾J*70n>v6ቆ:?($@4)Xs=^03KC"Ju녔ݲ1cTI;i^y"}B˕Ky$}~X /{*n! zMPga69gʅ)No(O&ls5Q):ˈX][j߿{NXJ'/{; SQ WX]RCF"]bˏ!ZO!}3t^I,tQ.A"p4w}+viջ+:0I˃{I E~r(k7^Iod~-fRV3HtමU"1k]x˙h#Rz5S}81cYCϳ;kDt9wciŢ^R] /A5TL*~\I'ᑰ!W.{d/4l%3eQ%o< _r-, 1 F X!#γ\ODavisP0$ӄe! w=784ygA$pRz{PmoD^#mS(;i|zڍ _FI}@{Pd LEF 刌l&P3cloɂ߽c:eyP:&0C3D-)i|⃫q1*4:Dd:p֦LwTzt LQF{[_owc6n?ԣ 1p :]֩i`Y=Y\K>cO5W\ɏ1å)TK"F`\SZ}?IL橗y &@H(<7=.HҜf:7Z0-y;PwMElѡ5^TQ_>>Y=_Pv@cF!aR͇.cA6ylV Φd|Y$lzQ= lBF,k_&ˊ_>x+Y~(Xw^T*RȮȖߪъ4Xũp~rb9c/5FKgQ@\nnC*dw@V6z#4rkfmcrE3(3,K6Ka iΊ" 0DznET:iIWNV-K*<"y*vez&:j 2zеEm"ONRwĭ0QD1 %e;1i)28 JTX5l͔tӡHBJ"R;qLhBHnAn#ߠ>Yt2+LcŷUp:ߧVeJ @w}ɋa3+ <K3SDeqk.Z,If )8PHEjJ@iC~i 6R@i ἴ^=H` Q"T4m&OQBd+LU&WUn|vZ,wȤ^B5U^]0{f#vqrN< zks|o jͺ[Y xVq}O*FY0}M\_-?RӦD?cEpw;L݌KA'|1Wf{ҫo}rbVefP@$9 ÀB7bv)r@$Fzj!r~]=H?=l{<)Ey*} HCbx .@y7|\K$JNJS/-8ǛjPWGT\ݲ"/˫>l6 :فTl+f$>n݀T !Ula!M0𖼼6 Et)+XxTvVRlkUb7ᛧyt@B^,YTA'ZS ƍ`h}kwǜuN}iZ n4vF|f`S.TiD_.Vj{0`|'m6; pd>Tq{)d&J7H7Kvٺ5y$ 6A)Lf@07kX 8\膯P~ˌ0w=rYEe3X%v=6S74K6R}!xψZs8aĉzPeD zMm RPiz#J'!8p̓gtA۲& @>0)H9]Z]VymEDe Cc)JK6oH9V\.',` (Ⱦ("1Haýʈ@L#bY\& "Ī*A, w-\ϩTEI Ma|,J+k By4 98JE Qх'1|j'R.T٥5S+]F;馜c9Ar6֟ݷӍ5Re nm _}=6C}9[%CCѰGOYS>%jD~7d5&4R G#e.]Y4 : ?Cf6ɑ\6\G6kl7ˍYn/OjK'H|'_zϫ?Ϯ~+Y <.Ń{'mYk]}o6_,痋蕴~ys=_>,^6m jzst:"Sʯ֠VȰ}GI5Ao Z)Vld/J3Li={W{o;zkv9'aIgk\il o>٥m5ASӫŮ\A@{?V|MM]3d>ug/z6ll_֛{aV69:Wj72FdX%\.xYjqoiz3kC0N,lWòI]}'Tx)=…R:5*h !5IA2=<jf޺cwzk Nꩬ 1jrim1?'>稟sVͮ&}{u5+^3bA^MvJ^%o5!FWr /q<nk3qToZh=)5c:;ս .]k׋$zѻ-_Iּ#; 32ܗ ~[dw[i+tӟOXC}ey{&).siEJg+wu~s3q{ΉDmLYlug*-nTGfW\3z'Q&x]EA *lq_*׋xrkTM씛Sm{HOG7zO ّr_wj7,2~, G scZѪpzT?t[A,yGIЗWݸb4$tf摒+1/At^ ׷f$4YMd71<]_o;ݦ)LgiCc^Ks5&نXGZ!>?FtǘŎr@ب롋v̯L|CuR3C ?og&t4r$ ^g>7noJOp]P\I.B! \`uI=28P4 3^ٶxvp&s<4iwgpJis- 3b(G3ȮqB>vqF}s`̬3/5®]h ]㩢zyH}  •s:s AIZxiQL^.jȿ-1ߍ b@) O%t|K283Jmsc{֞J*?J2_ɇ1CiGH[A/,,2>v+m'0Fr9N &iA[0jN&}Q5X`E-SU@ݚF_Z 5 D$HPIUUtfS\kf'z8QTV2- bݜ2ӭPtAR 7Y•oA-fCMR4m~4upxw}`95޴0#-._AuQ̜ E+bZYUo/ϣ[tzL% 5Mhު iA坯ΆE2PW1v9^\gE4=yce+2UΫTIFg9Ve!J%*6J>ɺiP4*.^EX*QU}10 *Q`L> F&ofBGu)[2\O17!iFѵim)Df8JlW/ckmf3IfW]V,#P*+r|c1!eP/xPym/ܢ.o[͊JQZLU#=*NMMvZw[࡜\o.*{ƷklgRTMBZ8 kxgpf(rZl0hZ>RmJƆEs{KJlQU a+HnC%墺Y H/#3Wƥvд^6Rnh ʪ{Mc 6\&:V׼ūDVo]0ƱLQv|Ϳ DPc }ÒjX Ge3H.u\z} B\6TL P#NJpDX!mm0$/LxZZm|!tD$ZT:Ed]{ǘ}0Ecl^*s}qq% 8 mEYʄ8XۄKuͅ9\4QkIC\#0L/x߹٥S)/WekVū Ϣ[gk(#8pbi*Z`s{B_2DXU/74R9RN 9;MWPܮ6apPmPrsmW<SG.n)Gm6R 8핥DΜKVܴaG 3щuр0K6l޳RlD RO93p+X?:VΙ3UQJacyZ^y<Xk;.c ȵUy@>"#@ZKTJ ; y^D][sdc87€W_ @0ձ]5oeŎ:n$0s#Uy]g)Ӑ BdQ&g#v:- R`Hme%.,B=M@ՊᣟB+gi8\M15:x l҅țI~2p^16%&t@;8&LM% *ui&aYG;W/^H6oeό3=b928\\Tg 61Qi׷umrjAy(W< tUZ i;'OK5 pȃ cZ9Vs.IVb>5"d;JPzw5)0CKγ)v0 ЩG-,š1sB'zQCzؒe)sl}7VbbV_Oh%`psJnb!Es[U }P:k p"s/o{;\ qB@w$'˘O]{!vzgqPrע=T鶾ѿ/!~Dj7M@IY[X?"t/?i-Fq?^tF~Uۣ] -F|Nƺ *þfʏ?}~Grs&$Q𣆾C)#LШ1Ic-1 W2v>@X5ׯ]oI֑|=UX<֗ph-+}@22Cv K"uvw0ƑCq ^aZ Ũm𭺭[fݼur'\%U+ %u]8#D1tsҁ褶 d;<{sީq{$^ G)Gv#e^~an߷Rb x ,^d\G& F ]Cx5*ؐHU4OK"ICE{ \rdFsm?Foc? L qD}^V+ˢcI3pWuhޮH8HPS_u'򏦠Wܮy|!BMchW^%27g]xbx!I)=S߽ [\սeGQz^ctt HDp-8lq1$t?ǐ hлDw7죧]3'|R̎@9bag }se^$A)%.BGE7 rX:Ttqk]-'i{sܶ4|n Z*)+gylPMG%6؀}Aݳoa=\qmǷnݷB[D0gEz} @ʇvH Wh0)Zuqg \: (M ,}w}6UH'E>$( $(H,`hU@(vo;iw{}>y WT통Rnose%[cmpA6wxa(& =75k2fU]Ky^=ؽHA}v4nh'.5zꝵiQu7s4ArE޲C2g ǽ#3^c%]¦ӬMӾ{zcǫ[{ڇmXɦ91@{iU;B+Ou:6-;s/a7N=ӺmnOe\tr^wfsCgfW+7E]uGU&Ͷ8;xkOe(g'yx[Lwq}7Ʒ.>a>wѮ^N_{hhybnKklnav;sׅkǰe.0Vؗvxv}_oi=-}}Ph#C@L @L@' l&P @LdAh#&#M44#$щdi=456#iژIڧ 7dFL@@ 2d24hd&M~m#C50&&T1 ))U?@JmSL5{&IHh"bd#ё2ijm24CMLLЏIb`jliMGO4OSL M@ I!4 S S&OQ)z$=G6jyALfi14h=M ɦ 4@ "DF&#@ `i#&h`#L @&ژ'K]~Wg8d%AAPqeHuDwqo-?¸f~hSz ՍvfťnǷhGgvO$~}O8:*#?o_)]Qj9(0y=>#ʢiۚ"0 m*-Crk1v 1yrT*0X&!7ȱ{$/|ބH;@n^?-JsE[;Zs=Hs&YA$FA@7Nڛ@TcDwWuҞcIc M$m!2` k2 %4^ ?벷fjXJ^ v@71lOr M-/k^qCiZ[˨˞6 i k, X$X>Yc'[[w<,8o/Ԇzrjh'#%ݝvb ݽTl~Rp4GjvkKה]~A%0NoU {K3Y\.8 (J7Vո*lAd6nTȞ:5ݺ5દ [F;pA(` xs a@>҇ F0gaZ(0jƙ:|]kɐ4D CB+L鿣8f֖boըjiF~CMtDV@)Z 5XEm8i6歡[C-};k/VG]$liȑz9 O1۝n}̥ܚv4?i"nL72fFp=ԉ1q2!@%ؒ 5%! A0P i0: r7)3s݊7 ]ӵ9kCx_p؆ڲ:hjQIɛY c-[nZq&޾ ^8 M[L5HDBylHh)kDVT* #DT5jNG îUʗt)QI@tFҏB`uF"KUPt&s4h/ ֞Yߡ:˜׋`t.ҳ u :BK/P@ar:~@(AoE԰c[g3uSTZǾgF?/+lW^!q=$J |&ѴhViIR,":zαaNy6tƌtXdڥ* Fۅz 5Z>ר԰+IJ thCc$u*M:A?}w7>R+X (SieV|}䋪dw+fA P"ͱ1_՝ ̝9Кwqb"cLM« ԠMV$\  97+]v o!f// 91/O1JUB.?;WvlUsZZE6k$TJ.k$فwUqДKxҙ>2 bWNq$n)OzQjϷy3 &t@aCgѐokͮ]AKע2eAZer]c}b|B"E$-Qsܲco翉>Jؿېm4̳t6B^]@@,DAKSS)xuQD8cDhD1}=H/g@:Iie=6Ng:9!c+zQbRI\MLcm`2ѱE#Ra-`Y2VY%ǝ(3V{-f )I5Kn_< 7}uvIH]YMPʬɽ(!3I ZE_1tCWC7T} 85L:[@|o-JSC޾rA' (y.|OTv2h/Ur-]i!U1I xp :[g3-͙4 Yv;o!qb h N#RCCX16v8Bٮi&Cl B7AB\]42pU,r""[A'K[Eb4…7c<ֺ2Wu[Dj%i--~R>tWNar'U4@(#z#zi Z_y1᳗T+iblI4otvXpw.x @j++OCI1 rrsz R Mfad @!9ex6KX CR |y=.rD64dTDB)aGDg"8Ɖ"[nՆoP.."lBFAkv yy !6h'7ji MmmFEK@mqOFhY@)j9P[W> Qel].[}QP g`$ (G1r`k}?ψX-uM"Ņ5ūvov쵏i_3YRhmZyG~ w 0+]NfIA3md]E1-5ag>VWUml;GG 8=l-MX.:;ݶpż6K^i"Vr|d}`gXcaUc:|Q~/^֒([BG ިE/½i=*H:՛_㩭kC^ _ }?ix3>ϴӷ[qٗJ#<պԧsWhmSgih / d4 f#eo*Y;j+=&U+ۙ\y!/aQ%dҮgQ_oGŝ楷T&jܿOya9?i&cw 4lf024WLV4y'S9f^8_bV@.Kki2߬C45,Vhׯog]JN-7(b{\>e^aO~ppKW)y:Z(XrqrS;JG_oO1} 4Pm6;YxS*;?w;I] :]C3FtYz! (7S؅].o&7ѽz~nj~Et5jsGUI&춯T:7K? ;c`CG4{EtմdL>[[R[EHnbpҙDCVWOsgs},.J5c<\-\VN*U+F{IV~/=M1ԟ/PídħEOF#{^G+sC"ꝵjlǧѸX0̰jYWPffk t,W*Ѳv (V )Sb2F 9,>GOq[%Ӳea%% WEQ6XRK`049چW2n僋.gF%p{DLvFa` _D. ~cXD4Hl0jkې#>#`͠ҫyY68Tu+z cs'W wQ}hp%r ۽$ `)N}=Ù|_]K 1]Q|%Yt4STuVPapѢL.duL4+пl\Ye0̂'|6JjwYSfH;KUm1/Sە7,yVa^MM`I[DgYCLnZJp)֔ԃә9ۨ䲥k#Tҽ0Ueؓ:9;s9c*3mq#)so;e=C]p"&gyޫ;v+0pt3#Jlܺ2N TV-nRØҷSQworZS7Po#uO%Ow.8L:NDoM䠕~;, K`}NXu+&Vfŗ՝WGxۼ:G9d8Apj$2@Ȕr,mUg0hXyg-. $K.Vt۪ 4 WDR#a{ ~9nl[苄gTOt\WRdfմ?+&> Ş,y3sb=I{c f]yoDh2CQo` Ѕհg`J*kLIk$?]Bŷ{yыKl,8q?445F2Ǧ*y 663]S8 _>uzΞE\M1Tz{Qk/WPok\׹6P3 s}nMnĵƗݶWfTZd6xk8dn欕_g2Zj]C[56]G]tmF{ ý|{3Է˟ͽ)^G6UvkQ O"7Ͽ>'7 RJ̬37(4'{v>Wf3^JX_D e塗u]?o$=VF΋YX+zzMV \6y!ܫuwXmbSy-c=AZjlZg_hZXgBbD`#d`-U"[)sO,s\Wg -w$k@ˣXseWŵJ=[Jq(k#^2H́imֳ11L6maywN -;bnN/at]SH:91);g!K U6+ugPnM5y?WR!lqJ4UZ_=rj ^/$F1$]{IZ=hdUjj]f/zkL#mZeDč#xM &ĺj`RymtmMxMкa.4L]sR شSH- Z4픱"lIYf4cu^ }/kuEg$u{N>wcO6+#AhqG:2>zw&d_wlx1*1#ez~ ܦ|Sv׾(Yʕ~˰qدt9vyM$o G)bj'in9u:˚Z^EaWMO;?W$V_+oKv#\G3&/]4j{xso3_3q$~;3On^,PQڪ+[1l,jV[+ד`%6~i=!DMMn5yKla-Ԋ0ƫl0mEƹAlE.+rXx 2Kog68b%6am(BkY 9@9o #CE"g\߄ jZcB &n 6ӎ&D^hչ3IaFNL'хpz²L̟}~\ОI|qU:!jX7!,* ],N ~R oD[gr¥[rsR-^,jħbc.\.Sdt[v}h]o&Te0~):ys\1^U YA`c_q]H5I6-7-.b髌Qu:sne*Ue Q4~0b4,6z1U\oez\z-Tuw&.1 e+$Rϋ6%ۣ5סgs-Ԅv*F)Rˍzlw-<ӝ9"4XCdG4 v3U燑gh$ C }殢0 h`F_h4 ``EB+5+WhO-\ dʋsu["}1 a[m g#yM( 0'hMpjݽV7>7ovV ˣ<<Ù#~H0DH-4(QvE֫7c٧'l^\KlsIJX;\q io)\M- 9rSL,,T^m~ƞ \Z-"o4ҵ sxa(|ps CL @nn~ymyWʏ4GXe[bI׺y cwjLg' !i@ &M^fJfk)%N%{IZʸk#O0 #'ivWٴe4nO#!b5+-,37V;(Hq[eUmEipЖ곥_A%9M\}};Ut. 6v=VqWʼ;|PK܏sZH{u,U#j>V]<kg%  +N#9uai<#"55*h`Z*uNzEꪢd3i] ]BBum<~xܞ\6 ovo[њBٮ *Z"G^} #f1ٰy-t,k1ڶ)i&P`BZ!g$ȝ91m^ u=kYIVV+CЧ#*k˘PC>N񼯣5 '#&ƭ}PCǕ{Cw5c7]⭻YWRa[ߵ 'Ǭ$rRٱz`nq5 C2Lm bRbe,UDAP巉~p?*!I: e}{#q~ECZi n9i kC-<ֺgcIlE%^r, A#tUp o6hă|}ăJLv aemXaTTVֽ}F(G1fƎM݄$v2;҆":@r3 j~8^N> {+ID/Wt+BIw2^FwJ̃IuSCk 튰V%nݘGX1L "2s꫍ %3%xN`gGGq*ͻylXB Xy<~ 3y}˴^RXe撧æ-^P枅6I9}X#M]ct\wK3! BCFėY! yw"MgxDԺh8@*in0Q5_nF:[F.fFy+/X51lfHM&ğbb^BUd#m>GeֹF*z?!R>Xg\2eF^FYB[>6Tص+tX .G䮗сABR[M6ISN$t@ӘeSF`S2MLdU S wo4xY-$pme+Xl 8_jJRi`WYVf:v{#mw3_JlDu~qn9{f_I=ɁqPvzMV {Vwx"4GH@5$H!=u goC] KUE!W kkegĀ3ӽI0==(\g>g!#Z1J}]Bg7*ѐSq]+1t~_eyZpM`<;,yϾv$ZuEFmc؏bXoba>kN3}C ^6ɜD%` Kg]@|+~tfGA'6B;'.4MIQ%D4/,.<ꦤ!CX;z5S 03ҹGJFBKߩ%b|pKi/xqXq ~d$nd@}FV#"!eXuƒ&pa0'2@צ3AMx*}&_ڸw/?؍&$031 `-zr^;(۪FO|ș o o V -.'wH#CZ{dؠݔTQ #ı_"k rޝp>;̿<*eTC x Ͻ1YcR/J:vVc2w v-EeL+t\TvY8ޅk|,:z^Κ:£L)zMSJxU.}A3$$05ђ03[6i:Bl1JSgI!#[wN[zs1(-,ohxiz@aLݙ@S }"~  R+ @CVZkm8NB'*asw]W?9Mh_ O!J*(zpD{JLS l6qp &)_vF7.?]믦 *y{`5%WQeK% kY즘=k1k՝q,;o^:'eUSݠ<Ʒak$.G=RyL|yWm}ԇ;| Xi Zk62&˫DÉ :) xfWΊoIzS~ ISܛbMOaHofLӕ6O m.J  8 -l^݄2_1 _cGrG6 O[ä/Մ yHMJ8lJUۈ!5:0 $cei_r!7S_ x Ft7롖W*[uqՈ(EɫW]+eJ_gJN@x.NF)$[ZCF@tlB0gs} [z޺6~H@#!-'w^wuz,w»^T$  ,!éfŒ[K}<`sJ~t(R;Rkp6##÷G~gs/F'^E!`>یUndg&8|Qê1 q-E$7{]ΰVO룤u:n.s* md^~o6?ջfBn4,Hwowif=V f{z͎ā15|RdMn"8<Ƴ@BLK_V Ҝ3iD J)!FK[,k 3I!&Fۨ]mAnFq zza篕(H6 l0|@Z<$k5Y\5IbKx/ѽW(e +}wALڧ@LHU3QbTȇ F􌪀g9QtEgۏZ8J'bKʔaG]މ۱olRTfE DkA'sk2Л|n_  $l+qBͥJa?A9{v0eElt)u |Ig*Q@T#QT?@h zz&Tnь]t%BYES`߶GJFnzNp쭰pX*Pc`&'k iWD8ա$M;c JzxWưq7mf_?p_0kem1>C|P:d_>x&4*t&7d)ux?cWIhYkԡi yt6Rc[O}oAV5礼lwM=\krc/Ɍ-b0?; o4T_53Ml[k4^5?|AF,F"bAܺxU_3}k  Mp$v*߼PLP%#l J #:NjVg6)'tC7`pnTyBڲ8b| f hwxME%@/+V$'7oL;mRf*%VOCF=}GQy.;OƭgK.F7חIЈbZOeV4 3 |ְ[ڗ8}$UgAv?@TF}|4.~{|l]C2nc[DￆXe2 HBlun;}&%`Lk[RI}aw_N)xà- p( pw&y~Y0E`@$Q=ޘbx_Μ+3;}yoT*XٟQ-Y@LEsCH,%b:P7ut9e-^|(le#D496kL1CqL9N=ysR4fS?]ڱӫ-T? ~/s[уv>e:x!p,sÝ0lk`0U=`eDR#l;(c !Y fZpIlV\2 @)$Rx Rܑؐ@(:qBuI)8W$&oo:"00?C X*E )3RrjCp[~zT3'E@7BS{uG.l*8L܁ ʸzYA!b@o7~⋎JJT|½rq 666Kٱ^Q/M: ;#(]dͥ$`Z|j7\UC~~? 朤ɔ=z;v0uF-#Uw(1; N(tvG[`C-/h \Djڥɶ( 0tZ cC&:zpwNM_ q⦶ŦRw3a[}R6xR?f?+`糒>jS 3uXJ PȌ|.Do?E"=Ї"IpX 6S~KFY>,w? ^AT{ ^{5[z)g2VCNU++XV |&dŨ# vhUC, pŞrAq0o *("L'k I4"wYU?=uq/(^yQ?WoRkctKlQqIo{97Ӫbpw1Z07%$C"ZޞڻfZj%FN Q$ID$^ݽbqC-GʌaulV'޳IMWsP ;2^_Z.< "¡_G 6sdlg6}U'.^|0?N٬r:_gX>̧6&>Zj'I> i5?RE1c6uW#+}5ϺI"A{>eV/LXGAGl ♪~EN'q8},Pwd4q9kH3SO p # Y88!(F1M} My!uMbvZJh'GХsR*{xBƪ7 :#_ ;}[Y|1k“Q1ؕ޽Mo36S!zuDw]wpgͣ 6s*J8k'4hDD9^-R; U-jKJT*{ڟ _)G|"سK=v+7<)kO;af5ZNeL,5Vb(;]i*sN2q hYPIϡG8W}+F+ H8l|VJ(Hnw5}Б+ڨAxZ;hzաK.'<C=8MHk7x/_s<V%]L_;Z]luG4(8S:IlO5'3(:N9!&"7;2ca.R>Y}ΘL"e;,Ψq#lD&rP0&| F2 сܪFW0#!콴o.6noTjx)1,;Y([&P~fBP1lAB}琣,0~i'xG|.ؠ\l2ÍOʱyݺc?SbIK,{vSʣy4T,dtZ}^ѪƓ^D;U~M2\ F`pZH|(Y d4N}s  rĺ[%?~.6g;ܚ^OE<ϿáH?2uʂuqxfn~ߏ69B-PCRoϸ徦dA'Zaw_fҕR>z %vLT=k kh?sVHP*)˓Y$z:܏dRaf.ǽ;b7)77uwobVSW|toOY`&:M3ߖx{mJb~v9W@anc {$47FjBWVEL10rz-JvV3w/j8B -+o2{??>%:gFY>\S@7m"PP(5J}̒r2_;,T"E-IJ:236@8~F"^42T7i#?seMԪ~ͣQ;j8;my nԥO"2WBۿ1le+s?RP1  ~KZC)?9*G;۸Dy1naX-h Avz#uW|LϻJ$( aA +f*o+ 40uO,cǕBԴ`YVq^+nJX 5v(_H qbIgҷMqt!qOWo/La(2T2e"PZn1^vvR0#@)A0 g4j+: v9v䛑kqѠd y$rrFiJ!%@H1PBc\#ex捖7ow p zt:z*ҘOl5 qs/B C,nMz޺(L mh0u*Q%yhaFi@h3渨ǡ/J!o]0znhHb#9zHTVHFH`l:eiy!8KNGpT_7o !CwjHc 3hߜЂCwlr{qՉak\GvF[Dg v´ijZ B1Qu8T^~ 6ִ[447?5VrQʮ+ķ@[K*4 Ua!_4 C.ɹPd,*RCMٶlE{b\/<2$4fN}0 b6p/>_{ȗUauտ"i5-Hh=&Sf/T֌3w$4<4Ԉ;X1NjcjFP#\fL u Y|k8rns@m:$ %V 8T?FZm$pW|LCnE{IǓs1-$ocKCS*4ɩd+MV+QҠ~q Jĩ!Er5 U+b$"i'=ɫ7yRmVn6HDlҊ?c#M0s3Da֬J R⅂O28nT%ݳ8 7S $=c*E0 ZɒQaϫi>'D{u@H\RP-[!F<:>B/Mm)ĞDPkd„E w-VHxξ 7NόܷU(CgZL6CA*!A$F1iQnW. з 4ٯ~5xm}.4mi8\ !z.Ic\j,89U6s;c*8s0N1gnD._0EgS.Q6 !gDwm U]%"" dya+<~MxۅZiAɺw6{UۋqB^0٣?BFTd 8h: zVuVF O1nH1|KjG0 e a2~?w!&:Qv>1v`nUN@., U?>һGbuُ`M6+m%@,M_۷b0:u;N8R:A+2q4r<:k|x5c$c3T/+Xm2dӼ$]їee kÃ~TVǻ ~]̖;%)˭bgF SGyhEkrq6'xQ:W30{[→h m쳪G`@ ^4,q# c|%/k0?:/ >{PIGX- AyX>h~og%h#:Rldfqq,Z:sD76?$% &S? `Iܞ/9qg>xM-+ ]i 7D!Āo \t.n.&>\~坚-S9:p@Cb!2tL eg5y0>8%HZ  wD"Tjv~mYp8/ te՚MiWu3!-9'c&Um1tՕYC06(@UH.Rۓ A*q!9.FRmp5Gɑ6ǎA[hqax;BZ[t|vAkh?g_j^S>$oތEa4O\U}D! mΎ_;&ӪU@QުPꙇ8$K_ta1hikrS c7o̗"[ AAEyxA?]PbZhғ4=ڽzMӃwtOuǿ;8SdSm@f#)WҤ͈ҳn~魬,j";Z‚'r\N|aϧT;?Ֆַ_֡W{Jr9ס<^п4;n09~FCssԔCeR r=Q tH)ZEFͯ"+Tں&zՉ'&" *RdǦ=g?&%OJN:oK+vcXioyGc5g̍SkrAYL&2RBG-zR=׵pAډ]l'HX ʑK(2TL$SON[:)?€~xٲX,@9G ciQ~ɫ1yJȸX7`sn5Dq1a]S=A=yhzkΑ(YԻ F(@^ЖƲ&#`7ގF|Gilb"4䠈a' guiPF-l1J 0p=Q@4trQ+=ʙt&uIku?ץ28~{o?  wt"k1%j.nVFW} ޮjkB1؃[k34⥳"(+mڟiP)b0ƧI a"FqMFڎdԝT%X/J’R;żLݻe^wr։&\0+ ٻ6j*&⊘TD!mSd.g>4`yT$aaA,]{,R7 le@B#1 4cW%l;!y=g'KK%/p+!+j5B]Si :،b+ds~i{WM%3B~NWv(ǯWLU!+(7%+_G+KE;0 Ҙ]X ϛd/3na, |!d&nY>=9 X-On{2{+s|JD7%a%t={kG+gBB^iF N ͻC9׿pt9/!J3!b?CDlP`yaW3g29;` 3@0?]'}Nv>9}&XB^tvg+i&07u 4%\1ȈAh1 `]TE*O.^5-(R-N;V8@m:ׁQx҅'QG kqX>+_ ȁ 1H:!*lT.'iJ 62!Ct1p7mku} %\ӸZ㣌6@)E GKiP%'(K`B8$]n/k󆿉OR8cWh+&cvkԁ>6$T9+Dj^$ g %ԝ" pv^o`(`{?P~dwj!<8ޒL"#Zy 4}{rAUHwvS@v&Sݡ)ϣJh Dm(F-37{b)~̦̓OmM2% *n8NdS*=,.%QW-ؒE@C?+֪Zm<, fxH(F:ŗ 'G8 1s=VOﵨhYcбI$~eϠ9OpIWMt/y˗M]hTBXp^''ib h8XiI>iQ0D!Xc8z:w8BIJ: @R 'j1KiqC{{80I@Xx򌼇｢U2>LAfG=| fmMDw3z2MZTgOq!)m$2+}vQV>XSETU R pUe:5 >lv;ڞ5w.Jz(9SB`mY-[M:sVx 0Տٗ?V2Lk^[gS|p0q;kSr𦁨#g'8VJe%Bb ƄN*<~:<ӉyK8)7lL1(Zu92c2m9YKYTa;ڻOR;X/OL]:_HX Rbʦ55UimܚZcPy5u;.ʮD=fJ5dP-$a [[g^ħX>K %q^JhYR著L0y_ ,*qoX+DRE1gaj_Wg) : ު뢵0kVbZ]P7fۘsPJÍkm9$yor,bgfk_rH m=7zCnQnӌBf惍Kqֵ>:\3ncQWY)}!Nu̟=;x=5b+( ?[NnM$' |_Xmw?^&J+Qgէ =<- bq/hdk/,3.  <[PGQ LaeS8a)((8dmYPvX>io&l;|*=rß'i,mB[V]') p-W)/nx*h~ޱ kQg"M Wd46Y ҘAqNT%WDKd$c;7wo(Dϸv=:UT^`$:!| p"D>{4 <6`+%;Jat`-ItFL9Y҃=A%;!+hI;,)-r{. S֋MG n085S 1F@H )@YR4%td==L ~rjެADzضr2ǵ%SaѨ0ELpn%- &zDbLcED1@HaG db g'bPn pTE?͠XqymMŒ'Kp}T+c;,{666!Þd?Pi{ JS?*]65an3w¹ SϡtџՑ{cgVく#U}4lJs4c|ҎwK/v<_plD!AISuݼ&c>]Xzk n;Js,I2);3Nc #u9HA p){7Y>\X0l>a3\(KVF03GS.eɒ2 {^DE\;|,}bUfLܤnG_N9+r(!2Ϩف|j*1r?WAjU }j-YObV) 0DW4 Dv,>gfpl&|К 4Ր/؛Nj7viӲ66d'5)u'ÝjQ'`~Qb&Á|tJp`t ] <]5A u!m0r5o-.vܝyZ) ;jh{7qzjHi# &s+Gm);LXOܺ|"H% uSP}zȋ|3"2۷Ӑhb4`n.%l VVy9f!^8mSɸC*~ oOvƚgv=mg%!Nn$X9oy x;agN /RӖ^a[!CvX-f$v* aٸXh#3{6&kYGF^MN ~MB0iac{[хdx^o1W&Y`5LGs?5.qC;tvXP˵sl#>/O[Tt)޺:6ِorg^vY;!aƎYaG4axTu5EF46Qؚ9j.8E5kl ~Pp&8kf.’OJ7+uGI7-DkM7P~9gS V^Ucȃ bݓkdPgwB֖]cT::\IaY~Rܔ!Ԝ|Df,nՄdz^5[˨&>30O6l9l>vvrF2g։I*}eӯ%4UYބu:^UL W[Y 6h 0:0o n9- yK 3sK^~(ⰬfsY>j'o!fs<b;QxzWZqUd5.^*ͺGCKOT!yEu7Rk%E&۽Pcsέ~k-#vщmK^<C(>[zV۷Q<_+t&(FEM8+v''FO P;@ѱt (w[)ߺ.ğS̏ƹq_MV 53-;-䋜U?7FQͯ+1\kkYًT#؂q;z/HΟ]ת_|Nyl(5T]]嗱fK}ʧB6K| >/ jrȭ{4$]u rgw|h$3$҇v0ؗ hnCfSݔ\c.21]vAqAAwz'C3rYZy4Ԡp$8WޗaH;5WIg+RUȸV1C-9WJV4w>j y|_TrQ59We(c^(9%U |ͯa_g][|hz M2ZVFNFʅtQieVytՓ9J>{% hduy(_n[=KBVL@ U<,ݬݒӞ$}84=\k Hihcg"d䍉ePi^ 3Qukrv|k`K}x]w=%b(#ZPm[WnՐу2_v\+l"1@;$dd,*d_3mAX?0LU|lɗ%i P@v0 p+י) D.!f0A5eXS >ZO*=b5Y|fNb ,Z(Y\U MjVOKb lI%L]2U9& /J;ɖyIiaS8|ln|[mJ%Tl8FV[m)0m]7߭J#Nc 6'"O86Du7_`8ECk\DH"y{1:,rޒɳ8#-E&s97aD~SNz燔}S.5:FS:qb"J8Lc3I^<_ +5}n_r \.,d#i+3XJm*{xfA~Wvק.\p?j}= BC׵Î:*p/ |PBpI zk̳7h){}R HQ-q0Ul(#7. L*@W߲@jZ |w7$&3(j&ZJRf^ K];LgS4-VL>(Yj3I]I;냬\uI7:_O>ln|࿵<+a!{(:Z1@YJoGyZu?{4nrNb.|6Ίg]`sUX%/t(Oш';8aVi[2If) %şņUyև-+/Q~Nz?foϖ~S\^>0?4NwJ̋3'ZᆰfL; sѨq3CLe,KMx)6 @9w1ϜRK2(.FfH#;<(` G30Ҁ`,J"l;YYE ( Ƙ9圮:&v_#\fD aȐ*'\&<8wjզs@ aTs$>uPVA3bRx_"5X挫\T߾抍<(:1"(w yxpi'%zO0l┽K1*L hICbթa*[f+R&ϫ2G&PBDf:d2Mhmg .b^[8ڻHɷLk~U<֌ɓٝwpR/:XS0?|Yd_[Aݚ]va{ǰdn.vܨ挟e QIh ("g%8MRD-MX)>T =I<` Ŕ+юs?BXZIcwylor]_veCm.c9ğگ2u/3V,[cO ^,wtsҮaHǙW˅JlfGLՁ 5K9\Rkpyޠ&e(#1 Tm+\W:TƻaqMF*KD<@,[5ol$Md"qs,cp,[@ahF)efF.Bي5z1X&DxW02?_kK^Fsy-پ Z$` hHHe g!-\  b(j}s#mQ ITXX`b@{^ 7Zͦ23*^F^NB%#eo7&hY̚S~%^zvz'&lH;P6{dԩmoEa7[yȬݤdT&jbշ&KA'ŎX{aA/@J[q~뻫* ,2=~E*Y+&#rT(ˬbpx%T <0U P^g'1s@~ϏERCO;&+'aĝWHٕסaC^'QO,<9~O k f,LRn_o[ PWJMt408:0J!r:y(5F#l0@(V` C­`0@MXf~0fsi25bDq-iHيg}-:io`!t{{`M(;}ee\,A 8΅7P9 LMs5 mi75jL1IP}_ x:| 9x[eN{.xi~.Gg։5S^2@eF ʲ[2D( .*qr[y+Œ:~X0閰rDUq,0bc;$  $?b1Z̖"f~m%)'&WԌ6Jm><8cuYġ%ͅdU%ngcv /yr?fG(E}i!R  avbHHj qciLOW|-@GQs>N fjѾmV;pwi~pΰ0{c5ր_(:!De]+.t< 8A!&E~A`*(|vbXRQ{,eFnA/bٳ S#-FvQma5x{L i =^uMmAɈڬ00Xw'w~§ڋvrpK662VVs7ؼc!kJq7Fڶl~(De&z+Fyu-x_{a`n5Z [Xw/UcCؾd\uv H"kq Qi0%؃ Dŗ H;/n %z9^?^j՛'s[5ф rW9&=4܎ -* O9mf.v`V3!ӣF'o!u}?:Vv'So=5\/xoɺ#JRP1[1\fاh :KI̫LalZgvHF$ 䫶|b=˜d.GN8d:/?WC (WPXoh^S))wRxDAb;n;H2T g;bAjt汸%y@;j48-jYb vF@}H)1( d my"]h0 +ON2ѣ>~^Lb嵠fދCZ)0$ÒL{p[gqp݄0gh 8H@i8 0& tؼڌ)R( 6}2.FyLۖ$1P]q޼T=j/:G^Oq#bX%s@;XM3:J!jJdHM5s `;-^f& ( 25p [?˖9G;BPdV06ۛn Ȳ%૆ 06YhGbLc J#+UISmǩМY4 -VBD$0!c^HIQNJH3bO.Q)+QYקI1TVF ˩~:\O䳈ޖtnw9` iaGxo@)B}==eri=% ;L nDR %@dtm*]+;_9 O%}`3B|]=%ؿ%}=IrexQj;ێx, piДdDhN,|FjVm ]ᇩAۓtɏ`?cŮ'?@Mk[jfB Hx6“m5+xm_²05>óg/E R&n d p ~A~7F"QK}&65Vl֩vRCؠ 9@(ۡj# U`Manڶ0,ɅBEpb+_ҡ(3@}~Qxf pfxs"]gǀD-A pZ.-V H0a?C`:-9 Ikףa>r5L!jԞۑ>ۚwh5`Sq}mmoZ]+vuvR7|ڍ1jiN9e<̍'eAҵq'˥Cb ȆqpzȒnnCV004alnG H<\ɭN ÁD'Qzw]Z[7(\a m5 ;2g0HbiH7 TƵEy?dmN;U ("90^7q13#Ci`.zYE@~{հL,m[NTnvOشl t<#1^^]-Q;1*6˖cw4i^h߼ ctٿ=XzIOڡS{ͽ;6ԝcI.藲:DY A6NBkx&ҕ]4FW7Q 2qs^A>j;i7AHERbqia+py o5;FUa>|%:VkF@>B* xێc\ Bۅ;EY[o B*=@7$5Vr<<`bT!tXûY|;ɷvbmNR`Ⲃjdd0pᒅ6p4:su{ 3^F_a 㬛ol;;Iخe)7Wm:q0"n7G^-֭4+56i-oNzd!胕VO~ƕ|j$ף_7lp2 Kb)d䳨~T9kۨ6:3oI?"яp۹טj&&sPYr]雏3t),*X^l2?yV)Zͪni8eIKnUjB]iIҸ*^4?OI1=w.wYt<˂^ﬥwARnKק86{MksN۳-m`N(h7#mͭ]JhY2(W_a˗D1>Ն:ZmN-3=9 dO]#ΐS[nfmBږn̅tvJ?LՐziI8v$ÐWNe5DdLW4庼pNSihE:\A4,Ɉ k^)ճ$2Jk{MUX3٭:hP&+Z7n5XErS+v.{fu`x Jrl70G-U;1dad̚ժ!M FXj֎LtL.%K$W/!z-l^[VFʄMټo0'"g)<+Xjԁy ddOaL b#Ts47)Ղҫ!- gnQb6[fuqbRymv ~ej͒96}XR,Ӄ֡O e`Qf@!(z$PаH0u05z3شzF&SW62DSreYbXmDM$CZ5檿$ޛi6U4:I,f%[ Y$RгN4pLD J(W=6#R)Y8b7&]2V>[o½/]fƃ@2 yJמEÊ#kw}z6Q}3٩BN7WZ[,w,;295u3yQÞ#XŧY-Iw~e /qt LPu=Ƴ2kԘf}\fúN-3VXu ,$*+L.Q"ر-SF4 [h 3J&^h^ B1s%Mkv^a`;bX,bZH2F I^b6 $&m#NE#~IR݈\h@sHA17IrtЁCanˎϦvŋ0ʛ.]I:|M $ɿm6?}?X!0(x? iRܺ{FB`ƜƠa c)h?kJp޷_yl[L|rGgΰ&jƱLtвBL޶9.Y>GIHB^чP]xa=Kd0?k{_M8>% $ wONֿvAnOl#;֛f<>iQ?5"x;C& b?_ /g|C?t~n  $ ţ4hHIMb Ce hĔ1@D!7꺍cl z/G n4 Á6x!&ND$H|$}grT[l4aɒ=?H kaIZ}!%-:yRА!#ok| xJ_o$=t$mI#4 w^DqBBAwpABH L4 TBI~1Ąq ELH\@ hF{@M$OzKR\6  {]H{!Iz'9|F3h[F_-=P$t߫K^ą{6uFkIs]%`Z5=?ȣh c<Zc9I!8m@9[|ҳ/{=u^ȍcvL;ܴW)$! g4Yi 4VkX6/ BZݷEw:D, >H6b0!vQ K4@`_y4cAGz;s,Xt8iX @]5(ZC;(I.5,Ck#Oq]Um,0{'?a,D{O;)n>K9%,٫lrREB?5o~_+Y}2kg``mS4Z=3МЯ0gޣ_wY3H 1 5dccNNgvbCC#Ky81~'EIȥ|АGZ7O~[mm[ysh5 6 (h1%gi4h21 *<8 {b$v wt2HWjH M b1Ƅp6DM.gb#+ЏB]+^ǻe h(ZX49 Fd!մR1ױSI|tR-n؀ HFѠ4BߐӰ-4<В 6$HJH&HHźhB $#X@_ /J$#=%kjk[o1kMmҒr䐄q6B7VZHBKj@Z@mkއג @m!Im WZիmVm-n0F3?I!`φж_@ 10X@.c0c4GHش [I-D! lo=C v G?wHWZe%"f ;a혒`pB4ZlZ`Gh@h>@ d E,&ЄbQdH4I!,,@В1ر z f M@Ƴ!$A$)$ }v /)dtJy{?w#ystV8W8~q@G9-Ղ@ i}+#$ S<\,fB[G#8SߗJP͌ѮjmdzM@YF]S^[˰vǭzlƬ k;?NX\_5E-O!Pv%j%{΢э*v:VJ UkBw+)qa}o>6a"])u1RQ^*8!)\,-H@ +ܢҹ98)Fm9˅V&cE91{2 0ٯaneΛ܄!hz3BL[Zfc*lҎks6^k6 ay\e>6զkԘNymMƪ4Z46_-*S-˭.UiёvI0=̯1@˦OSlϊ™?EĪ B-!ٳN8¼v@!,.ɖZޘ2:yU-a2ɪ(t yZ^ikiVFh'_#R,nT;Nkp֔>b9m^1v7 Ns`IOOfB2$yBBf8@#rY48 Bi(bP~uUVHe# >|VW[=皋d{eC碽FUCƧ:BU9Zv:Ѯ_pb1ZyF)Y 7^nfv%ٍ mdk°4ͩjYXCUi+ՙ5 EfNQKOjY]lqB# ts4cяjXn] ΤY_1wצ.e$ ]&,^k4cĔ7D*r-.BGY` !$!5a( ~(g, CA$BLVhb/1{ AmP[]f2NMdčiAP0(Dq ~*HIPPŀɱd$%HKj*"ѰoCom!EV.nlFRq ! .ؕm !D26  `e+im![Η-,ԦMITfK(u%h&4@% l /[ĠB9~ [8A Wdpu5(*" 6nZUӏZ8|^`'!44<槞ʝB k-{Y9*fqi:9i%]WP|;Uە_ɉy{bTJ&oyCgVG?]Q(v͘AzH@m 5#@DiJ\ai޹Wv iAM)Y-"+=wD5}ڡᷛ.*k^j.ֵV^' 2Y"R³Uc6 ɨQu+6{BSkϜxԼ;2|W3 h ՌH NtlԷ0ּ]/Iore* [{4nf(L,Ȱlm-@ oU8֘r|vr\*r]M&$r8l H`%*VPƆYuWrn2&3fͻc{3jȠb w&`[Z8  ,d8i$ _Zk[F;ͻ'&߱F?y Mɼ͸³dE4uz/` vRZy ec]WNdfۮᓫT,6j(ӥƥ\j֬65ק؈efmtP©bĄI3F$ѓ!̃^ai ʫGeQG_mfϊIgarE sotwZ~Ru]S܅Hշt$+(U%g _8*GQ%"$[HGiD$UR s7F曒M}Lں1ޤBi^ d_)Z3 H³tY6mn[;‹\H?1a#a4zɼXNkЀεvSH#AH/ ϱ"g)YGD8)0^G7t;*.#3vv*DAY5Sd.|jIg4;;[ $5@[q>X<#iZG? S|N~8 _%PZO%oyU~#4mH_'_:\R XZdZyg9V/P5z#Kǂ |ۄ6&+,FnU=H$I lBf_NT>[MvGcO+]m Xas 촨]K 5bCE -K@%뼜>Wat\/1@j`4HhB &$2,4 BI1Xm]Mm*߷mo5?0<~BHT hB6 j؁ `0$-$gk0HKZ@ mj۴jWsZDog b$ 4HlA[Wk_jv־$| sBH7TB`4$8,B+d`)C@ A0q#4>:K >kBKِ$$7IuVR[j#oVi!,N$  $䵌!h@ v$)?|"lF{)<ѳjC5A޴Đx5}jךk閶k[\b%bHRf[k[֫mo6~jƒXit GB?@'n.**,I3PGeL8$!K.$;Gڅؒ50M8` ;0HAАB|I X` G 콛B,4!#Hh#KhA$$P5LKs@5?F*Z8MeGь H`Aؐ%CBִ/ <﫦fsM!x Rď` 4umoذI @`,lN4bB==F TͦVp>M{ H#/IBc% .}@tT$}HyLIfv/#!݈D+F_տx5m_oY|YroI%4#`.Kj#54$ #M +Qa $!+lGZBi.4١_ H8LB@B̜>G +^rf $eh5 Ki%^dBi%&/USl"ΚL`_}^A@,$B߶dpEY]LZ2pRIXA7Ɏ`|)\.~,h\6lZbE /P4k/f{4CEM֖: @T  )IK&-ùCXJKkd j6iM,D6!bA L a]PAчH7, `Û ({dY8HI${PTAJ@c =%O!F} 0h Gd<v/0/r$jPMsqN,ۼ'ϧF>9OSy-@!G`Ak\jЭ[UX*)Tkjm} ZN3}LDCKClBUل !m@G3?9_]oN52#"Bó V^pz=4!wѦh.gHRaӮ:9IŖ++Pذ|w Yz]Llch.9Ȉ wp!#$FzVXg9hȀ@XY@i>ϺW:y']ֺșMCM`iq^ؾ-k(}2(NY$I%=o`~|-$OTf;!IlO~Xꄰ9~w%s d]q a<*jt FY69]ZhP4L3@Kq'.pvvʌ{WqޜHz4׻ui7ZB%5RYŵ8  .+^PQ!Ч p+7iY\vgVZ ș#WjEFrԦe߭gXhϴlBXk񠩈@M$iny~G_S}4\ sJrB@@ '0 =:|~v-+V*u]!%[Mi`cye_}/VTaCHb<(ez[!Љ 0l03k,eVgD]kSАCօ~KvsbQP|LSϱWnwݰ&DU߃d37CKrؗrKT>; -ˣwZo)+6b鮭7dnN?ټ|tjIfUGm?:%U*P#؜r5TF<[d) 3&QMU<}p7  Z $@ƒ=m84ЊA~p8)z?!F5^[eCht?!P [0'([@ÝFrQ# !/ Α3I1_Lo0œ~ BEmqd8  Aw3vV|M]e tR% LH Ewq2z2sJS`@9N m]#]+qI`lH!$@mZI ..0[rQoN`.(P/kZ)sj9svH/4ӧ=,*)8{^< 68")1#t鞸b-Ohj9P"Q}Ury n❽/,ø4\y.>Pؐ,RTO$6|[6&ܙ쬩'oix99ݣÆr"S%a(YE3I֒^0 e2$Ad ^_ZhdܳJ $ ɇ0?ېIOi. !|7i +@k4cŲ Xo(cCMeeб/ FJޟ5]1oO+.NrȬN0:SsmಁFҹ.# E EU}-]b@=rx.߭Է~R45UkT$j0rT@jP&ta3SX6; o0n |4ixޗN6t!fh0)xj3<--)r4)X(9$UhYLe@3՟.Ygޏ \,VX9Q Hn5S JBI-<ly43 03"27H+dCNM(BD%ƒ*)(5S-kw{>\v9sp:J5pvvW60<2 HI)'(>SDB""TȓmV7nq\mƵmPMa 8D42*IC$9F$* 1ɨYo 4>L7>)wULJuňc (!ŧ\$ ƈkDқ&"$&RsP8MvUfB+crm Fͮ\Q`cԪnW&iɊe3Ư'BeJN q^.-ЋdrIm̍54ҨM=T%&bD Ā+@F_*s@]<\030pzK*+ 휭nh2Z``ѝ~tM9fCͿڹ^,D5uhHs иE& JUڕ5~ʚ};M}Mǽ.\W lHAgP{S¢FQ&%:^G

r LORL2ivR ?)i M" ɔ*]OcL&{lB#M&C#:+5#&IRХ"-mua&ss\*L(~ΖWfQ 6_>ű@{nt|HXR1GrOcWj(pN6ȅ"]FNGCHKnmQ ;3Hu+oMMJ42[B!}uzWFo+7WSb=HhXd¤Dѣ, ӝ>j4^HE4@Ay?/eǯw1]#1QXɢƷrj^59ykWL2,{7Np /y1;.*$M1B;koCaFģjuUUo^( B PK8x'^,&;kL`6GU[j[^]ڵi p S`6 m _mY/m&~iCt[w[*.˸b(3S ִ4'йIIRmrpM=ǿ1\m}.ulX-4b\DCHmAiq4%*lyT זܩwmg4@ $ yz!Щb|/ H[( uA rNE1Сb\,-e<-Y14$a xX i!$)bHAHA2!pLDRs&p 7؛$iPi-#.nЙC &ם&R8F)5sS nΰ,"RIQx)kTjITjHȥ :8Cڲرj;]H-so_+8P6Mj{]'@[b7=#BRhh2s:Q8Å;@LYP/#MuNn:oF]vÛKjIo,4BT -Dr&G dhm+,lẑ̻H#9 H[\H%oxM8PI(A$Y}IJi\M፨E!һ/iJ$Ҡ0 QYPm (2\bR,G%B5wy+жwJ7ވ(ɼyiquIzdsTfvĴi>%)fT/j2"L:dI1 ExEYnUĭcGjSJ_@s4@u=(&4=/={L%FJKo#\o-mImlXfʕp8FԮWiVD Jgf^NJL36:}rJ:uUmtGLZKIȣ9X=]u_@DmDz]ͭj*؋EEZ-kch3,J>-qX0llhcmkUEZѭU\Uz<ױѕƬ oM9E666ll9ېmks{'wk5Zl`jъ25L ,}n9m%RZt:gީp"$hyR)i J Cl`.6,T RKC|^AFU5"M$n[(h_UF1D&V& 8*RLJk64XVirŪ&#*2Z#Am #^BD0!$,7y93z&ID[]ؓi&[1Y/ёշ 4k 0ES3I#Ll}Wh>d=s^jzH,TUGllX)Uqo A֯Qo0nZi>tpA "H } r؊:ƒ- }Z;I ;e@+A!tN:+M5ƀxGL 'x6Άia3(;?{\OMןBvoUve\W7lw`q{gd4ͪCV ʭnE+l{x뵘iY]hsdkҋn1Z+h",5 2f7N~tNVl6Jj(j-`B&HIRHDuH)N5L{:蠉8,?K,QhݭRTO.ItX%G04f$IA=ڏqH 2ڣJ *\z^yor\9\1 S!2Y]p"6^xMȊQŇg9jMo>͌a2k'RA:cR$i luj\0(g %+%VSvB<抨 jƷQ. J=JEFrHhɴR8DPE -vF*L7jVE[Cl 5 w PP! _[7`ǥ\$N:[_p/h!M׷S cB'8 Cb&|6U;xS>ۺMu"2Jq1D W|ruOFA2FƦY7hN+5"bYսM̾EY ʒ-cb!g5J ^t*Q(36|:% h-}DHQl읦 /)ȼ0 "_;mǏy+?QRQ7C *20|ƺK0 ljE$W֔do-\%rrt.Nf Q@&W{Ȳ&^v}Fk;<6 XqG{$kLY@4qe5_ ~Gw@F7*.u{@7\se rC`-}a5N?p/\<~c1,/^'w&Y~}O$$}YS2> =Po?QZFi$uįp>ЖuW?QjboB!"J(I4-FA@s֦?tY|YvLw_V(J9)(y~Z]]ŷs7\myu:ZE);;P+LW.6=>-1R"Ib1r\ߣˢZВFz>00#b*X! %6e.6\I>vz^该m<sAڿ>;V{`;xOTI.G˞Ҫ0E$VnlqOSU3;2?Sq&‡ -ϓjQZ\`AY||n0Sσ @*G7[to5h2Ȼ2-S9BBHzH=k @1%u`%`,0TD%hyRt[`s}B#>:mZ20)<j\V_W|ߙ/ጔxT'[ A @PB H$J[=pg$Z$Sd@=MQ5YԳ *0 bgR p f S&Gܥ QsecB0>v 1Pjp)XUʻ1hBt6іÂڞYcOlOЛ"*J`)'^D8R ̨tP"xD;yVorH{rf֦/qT9gHj^'A{8&Pv(mɬ\\V8ܦD[I@:IߨpQ52sR_Yn3qpU^kWF뚮ԯr5nM%D)ٶVTq8|pt~lWSWJifn А~B^ݖe𞖛 ؋uuo-y|qYvMiˬ$=8,Q"$R]Dϯj %QM4ywUg1i;t+NPRMJUvb#qՎ16ݧ L.lϯJ sBTUjZp.* O~iVeƹp.\dJ7 Jh}+3sՓz|YnTEÅS/}މ_ӈBE}a?7tELOA*%@PY 92]/YO8?ELSZOȥ ^g8-OM ^JKVK q/4e,Đe:JW&KOuOӪo3U*$1.Ihyi^%pԛVWx;SPXyw/ 'mTN %MTƄ [$pZb=u|ᵮ?;<_ot!#FYwq=K'uxcQH0#tm;]Q}k R޾c/yG˿t,쑌 x< BHp0:=:Ձ 2L1xevuf{w lL;Ww )Q[AS+µMeCXӥGJ/|d' k9>VmRT!JMkTyêit2WyPAYFm]iYrZ&ey:n.AŁ` rq@rF[e?~ 崾wg[[e@SgOxeTǴY(ƖTu1z$wNR^SdjރfĖ;42a'~Vٚu^~ՊT鹒.Oe~bp{2/OퟡņeLZϋ @>yB5T%&z^nN-V]kMCﭛ \>Ζ:h 12.X~ BAvtb<=RX6`uNh026=wb`o+_ e2cNL60z.tmD&YUؑ#졥yIvֵ׆*'jc*5w&h/ UW72%Ti*wo &cJkhpI 1-Q5J[Q%iITIZvXaV Rޞ49yKDl |MRIĦ@9c`N#'e:pȗ 7uoī*ӻRPr/ڸ)k2&Mrͤ& Fk-{ɣB1M!m8o&0w.NEoX.}$@]#:|,ŒOګHHxHK?QLj6gX>E]3BYvdS_61i-\PxQkǧ}L<0фc"9{oqQ8 *OY&K[nZSZMr“I K֐_szgl]Unu rXw֩ Ut%۷?O{3T?~7cX˓ƨ&_w&L^e=>cuGJnboy{t[ji5Qxgs_X].35VaH?ԱƓ귄Q=wۣo%L8ǑGv@3&)ٔg>Pu'Q3 )`5UA!BXQr9iRԓ &cTf9vF3$w^Uo"jM)P87@߿V{%'%nJ ɽ31VŹ6^"暤*hQ7 X?\'E:&S?H>J rN pJdΰjEs7TFAbp΅ ;˨Re_Ӣ??WaYdh[&O_sq1E|tИtS!(a.و^ o.8H&60M  ={I_q3[?yGOGdm>t1WQDL~i0]&{r7V4*zW61:(SÕo'zW-J:?;i=!E:&fH?z:)ѧ)z[X &iyY/H/FKpr$>W5 N]|Of΅@M_ 08[> DRa`peZ]F|IHofiG!IѾtܞ?j?$wza1X @>70v }+;].^莎 $2\g[{.$"֔N9a٪x1O)J%4tvcD;a{noxr?d~fznwJ/`"%-9*0QT=(MFTA~G[oE/>&6NO:=K%{u]*)ku5ˀ%hCfmE6ZVס6-F q֘E<\_CX0ƃAl0$]‰†6,4U~)(`Ym6GW$+ AR \Q'E禚B5, "=|K0'֒*{G)+mꏀXeT#Zb{G$ɡ ޴&~g͘M/ɲOSGm];Uֶ]}-i4|Bk F&J IS+h6L!Bu*ek(Q&4+.p rK%Յ ~sI {fR)W&Zڹ]$#2rC1Q"}rn"|kZ0OaYf p&iG3l=p-@} 艻EQIj3:~_-g,g{nêMt)[`gNH`7 Jz Uȓ gzUtiTqk2,bMeҖU8.4LU {If:Zڭk-$PI`5w'0m^ʚsə >Ry\_Er}#p+[hl߫f6f)rղy(h&}{'JuRS#^5 4R{G9\;[2e_q|h6BjK]KwtyvDyfeNN<|D"B/ 2bE&p-2 16eEJ .>IƦ_nQڥJc InO3RDz# *Ǥ*5(S)Ì=T/#;@w%h9>vpEM@ $6ͷ""l{Aa z xownZzT˃r2[&OrYnG".JveEaٮ.2;R͊4]hAjN8 626zyG 5')]<;jqڱjε?jɤSjb=! V5vm{yۜYd(KU@w״.wssSI%_dbUSx] ,̦$1Ehqg"@RRƻ.S5 <G"rʮ򈿙k'g1 ֵZ÷p$q@9舛kn|HNxc>G~qa=:5F[ViƈՇM7tPyR?QHK,$5 !KoZ@M]AuQ;QU]Ąb/~0?yRX O|+ ro{.2{lgYIJWs>/z϶u1L<W;챬Fm^#uuu}\-v~Ow2@PޝC>%5R (k!tlE?2H.`A֚љ_% WxA#ËnB0%- a8P n{vU7A/0sG<ςZ!nįJfd +P 7L\RZ'E^VE qi5jק*B]iZH+ޒmPK3s_[ M6mtA,q%n4 hqUAޖϺ3N21KM*,I궄U6`Waآ9&yĨmLɯ[+ަr D*ED! sN4R$Eo"P؝ (U5Wvs Z 2J0P87Hɳ2 1b$hhr%o#99{_lRᗃt ]7V.\~߰~l`vr&n;O[|ZRFҩ/Z OᣧVrZ"7  Rg03ZZC ar-!d2&LȀQQC0d܄*p3&uKunCp@4kI ww_~Ai`66FBKkZ@,Y^/Ktl'n!2V*)=֑Q.} )u8 K+A^d_94n0Wi,"+JY<}=˧N[gQ9eѲ%.J{ҧ)`X BL\J~ ׃?'u,% m,N6Fc,9 k@HUB ͉(`p[M$%q4)K YZ_)L,TqraKQ]S.9x7p-rX~'?otA44vSGAD)818+CMJN{t8=?Zs3_`&PqHƾ[ή +F[%kj6 komb;W9;f I 9{kH M:8||E yF dh(JiV_%X>}Oڿ$A QvȀ:L Kqe)Nr1W>3MY :+f*r P"y[mq8Pi>c#,A~uy-@! gb°hۅ2.mZiє5$%?W @9ޘfgEF߮R)ImE並1- Zć$\}$t*Yp ~d$n&ngiAvȑNh|UHj 9ͨVPE 8ho))&+淡9tZ"  ev5Xyz:<0F"F،DՃ-Wj"SSUXqXV+[':RB\ѱiuЭ莵sU jsIFDXB4C0B~= vϼ_цa*PP3j'Bb,FUa},K 3C/_)Q߶hKzd.Ζܝ/h,L er&bu eoPi+^ttW6|12l7.&ZW6YHSN&6=Ncx2$9ԘI<#e9w܀5W]~nW LRT(B$j qvUW#UN s%NRɓ u`{fy..Lme…xPu'2rsm$ Tp72ec*`̩M/HEM$?>s<7:X3l`۟99K~1)\d@ WI!jSbDܩe9TZa 呕T1ۗ+]Ħ<V]Ӄg@Hbe% ؤ䣃YV*b{ŊIi`uyyd;]&Ea Ik.\ⰟqmOѕ9纩9e (\`K 97!K?$>/9q7<)%?Y| eNf$ʍ8c1zM_IwI:K?xfT<ϽNY9H @uQ*{T8]^$ݎ,T)eRP5lR K-#@yl9T\.ŀaܜ}M~E! mSV,fjrl%h0G`/wxUw|N=d}[w #Oʵ-5 cW)jqM}]]x* lL,y91jvI.G nc]zn/XF(*hl>8_~?m_WnBU.QAjp5FaxbʯF2m/'TP'~ԛ7ֽ!l)AOe/h>/pD<&j{؊>.]Fo;>[.QМzVg:DI^+ì"#=(1=* ?/&Vmh umCzBI}7ߊ6?`ͦp~U{~c큀"0\ p/>4gD~\JBs,§"*[(cv^©Qfu˳3 cK͎B!}]@[m:luHX(_x^!R y:CjDM,zۦL! @llB{Py#0  { 𩎃 %{̃j9xC "̙Ka9q66ݕު6֫D64#GFgع^6˕U1 ^k8$Ӌ3 JB& ,*=tB#b BoTuuT^SVqT]`e`?`͢6s'ulWݓ0%i)d.O>n_@`6mZHRѻn>BB =>wAjI~;~5kךj-FZ60|:xF*I'O6P˜vwX_ƹu@&߸f>|NRsmV!Q3q!\Jըڵ (h" Et{`-i{i-e 9?9 k3ZSqJ;#>=] ``n#H Ht|;  $MZWy|/ K\ɀ-akmv꺘DMan)gTQJM+L\0^_+]Z! *=v+) M ֔~ՇNT%40 M=+uGа! է1N_MFOznRyb.'à7'KRz[ D" (E%\\+zQMTQ:_/CgSZ]szssbl1lLh4 IՑeχ}VϭJ#y2 vQUtF3\;`<ѽ.`:?rUƊ$ۊ215a_ŜGQ`k=~d$|Ii mUVV-XQmJk&L6bjURS3)$ h45JKEߣW%2kfMQHHkQUmMbL<,zoН|Is湊\>*9>gQdOwHQh7䰋Tz;'Oիh!&3]5W~kCmv'};i&Л5L-o4 6bu9w<(,hEe2'bd-i_k\="B"GTb'fleȷ+\&Wp_W.S3WKHG)PIfaB-u٢R:ۅm I,nM2Cb]\7kWaDzsSZlo> elBe.˧DI4F/+mbVL(!2* >=3b ޿Pe\ٗ/(do>~~V_r%tjU<'6nF 7 "wZ-DOwUM~MOkGgDy띢qy31ܾe0eџb͂nKq}FZ0\-C) ,4=SyNomG:ʸoU2`E`vU4_ė˪ }NiLDT}HtFGlvg;]qJxGY%W &kxУyG{㟐hpzG}?ioNo˃gi/)7-rdX1x2D` @uSjTK"uH=E ]7r=7ߙJ,i6&sp*1DpϞJsΤ%/Z!)ĽD!:'Y-wҊQbLh?nkѥ` f{j$0F6$c8L>,NHT IK[ӖyIgPqk\I.;6 ( OpBD?۾dE j[ [jv̶n"P 9\$*RwYb"rdb['ؿU}/jgW%&WK_a͞O+Y^*)HݺE=Aź}n]ɍ{/@[Ќ7QD;;vUVZƬ[Z"""oʥ=zكJǃZU,cQR/K|-b(ml8agڭY.av[WNι Vl?m{~K@$GC ,.+ɖY5~-a&$x+ٹS9rC@Đ`LRWKvA a!r#CΗ"BW1ֻd@Te-;=+J^nG9kvsP&RjD {/~KL(Z61N56ZZP[`=hL66(5y=w|&66)gcTW9`?_<[';/Ha)SQ){zU?=ڿ[gJCz_LO=ک~ӢZȓٳ48O."#]*<#pLJ b,e Ce/BB K1aT[xTTAmA_>eF)eAK(BPBLLخ-Z}Zm/Č!XDxt]:r *0 & xmBozF2g gF嶴Py}?Q>5o]Ēy;) 'ė3XMkmowE{,nQUBRc`/G[¬q^y]GWYּ>xnC D d64 a9ʏx[*q[`,e=zb D(;xΞ# 6AɪEvI=)0" #"4LƍOS& b֔Z~$t.MjG[uз7hŋLr5uEyCl.]8{wl5!R>h=ۭy 31 G9kVqb'04 ԓE IPU!%"iGQ<(hap୧qR]#{b2O0#s{E y]wCHb)ct9 s&$r|Y$M4b]BF]L5x:I BICPQ~?ЧN5Űw3a^EM|z E",Ks!@ͅ' ]Ae\jե,(mel۸Z-h.gո6hѴm"VǷWMV;ML1g˿١mzEJgy9!3B\!uz݊\,\?]t@ssGҎP3u{]\u= XcH@A/g<i $CLcq)!ߣP/(H(xՔ8Yw Ive$M!>.K='1swMi&[lnk?ХBx$<ڿ ŧY=!oQD4Д`[_ !~o{lu}W4dU"$S5/wsQSN1#2lPUIY_7ފ$Fq]vʺ䍛gucGM:~=C&SL@7pAI cSH-Ϡhp hL<:xЖ*h9̒d cS(c(_P0}KXLSG8EFW(h.rG%coK{F I{')xa| `7q11?qR:%[ZHlgA|+ҠD5K% 1CDpN "cϐW5e RUP٫Zߤ=]7ei V$ Y4JFQ3@ Sh%A XxlA9C0a_3%߹.lʗ.f "#rF_ 6$-^U2ZFSKQ,Ì%8Pldoz4^DةjIAW5]Gi|O暽b#LMs$.{ӨȔdۃvQ7R1࿵!JU[~Rz"|rD%C/l\l?(ݸtjUg`%?Zz]P E4W)tXiU zY&ޝhrfA'5+U(& 0j~mSG["XE͚-j"1t [΢' WP\جL`{uJ՝bs3ll^HYL{V7l 6 g7to#?ykK H؏4`&o]8weNު~#A_߷F_T ?Q,), qDJ `$0~$T?G􁿖>WcI#z[L-7\~#~㉲1QPFי\urI!.y 䵴a6q'M5 U_?~ .Y;f́yB<&\)Dd Dzk0$XB(%`Kdv*+߲x,I"GK#ummrٵozM׬>?bĈdpD_>ncTkF  # @-sVn9~Kecm(HIDBc VҰM179XjðwQvEȨ6MGʿR,k2Y2KƆжVblOΨtlAhcM kx`y雷U Kr |:`%Czm lmy0#-^O{2(ⶅ[x;0jgyC˗lR.͗oG9_vwZT$R1a4f ̲|YkcUJзZ$  L8N24nx>Uvfvʡbֳۥ`p"ܡӽ$`9p-r?6 3}F^(#,Sb2HЋM Ϋ`C ۢlj4Z흗JBgw,HƆy>(a/̞ދ@R?>5l̹Ssjԏf4FGHD%nE04VГm9])8̩q{-Wh|_|~4OAjHDB$65:((`W9}n& 2Fh~s~n~dS-6Pk݄R& rf#.gNYWDǙː po{ KR:fe3Ǯ1ަ/c񞷂u* i,F$ABr?Ә*yoeAGelQ(ˬU ېb钜D5nT wHv0.4L,7T @9CMiH̥61Wwv:I4u|tnĪ3Xs ѝneĝ>fF"uחxcx:g5! Zn':MC|+6eXg .sϬDo\@aQ  IB$~l wݧtLO?EK3ŀC޸}ŘrED BP!?_~&7.. o2$!!J`Vf̠x qߖ*=Z,HV𩕀X.  %BE@S  :vUDТIД (!($E@h-4!4)br;AYtHRV/..эF*siG:u}YG.y$g].k"eFiRx"Ҹm]Y/hBsrHӧ:nsye;Y'j=Dj5wn)__4li%qd:?'O%?ˠ[7s_g[%Elإ6~6$ZTD:hon!oӹHՕP =t=_ L櫓3; -'/ 8mY9Hmqrd;BAc]IȄo}wC:y(г| |5#;0ܡ@!4A\LO`eԤH x/6[3M+ј%&Vh湉zk7CphHh ZzQ  V Ɣw|\/Q'8믘64XACM/TlvKom?t!:v1è7q=yQ貀iܓ}X=vQZ{#3:5caf= bMrccqb8=ẻ=y(;WeC6: KzǮ? u^yy~5b6 46c\P4ڙ|m*狗W|6E$fۓK~s|c<1$m o軽^ӯޭ}lK&)CQbz^e>{J}vRx0#A% 8ֆ_ 努:yل_"Cc` o* JQ OpSڵ+6# f9f9 &4cp k!m'r%]@Ÿ/fUp.k~5L] $ א.^ ,m].<4l'I|chsOa-ͯ:O>d|+0ؼ(ɺ+l.60vX_.zCb2oՅvI]4Q HxA  >TQk@* :ә3 O-I֛¥ pXc$ ذocWMOHyB:;Om PY] A=Q[K֟s[Gg#Urjh`v{liFB5A C^S0X=1p_w˘f<`PФk?DTtڝz_n*@Żҁ/$D8J99Hg.TpH >rпowjD vS_MF|>avC'9>g_#l )Vsc /vf?/3Sc]-LBT ^sI e3k<8Rkk3v4,I %&. H5А "](hVJ>QA޷Ѵ–n>3j@OFN^1$K5JS?v tƚӟWYV|+e}N;+o@z ȁ_U[u^+WpnB^ -\ɃmlbEG6 =kpxPQ#~{Yy;z%s(>A~_lΛ9"DDFu}?߱Xև;" F DFW?BZ|,#-f_\3V uqLZKjn aZI4>|7~+ƒ}uٞf'zNCo?SQSWwvׯѩlC0h|qבh׼}{H [mBBhݢJ| 4e4qhw˒%T%lx/c/n;1 uY6V+ݍfʼ}/f}TbpQ^@R坮:G!Hp(OowΓ11b3oW f2dd L`7R G!=^sv"Oܔ)5CM> 0q O)<߯ qo#om(c4=TF=Ω$rdN&wf0ls䣚/X5lF\mH/w[޻?[c64q$PsykI%XOw2m!PO= $/wSڵO5^%g$U=]odG: :`w<:۲ Ed*?o-]wik;wL&413P5E+q1[}ƎѻA >*@ #48d#D< sEr_p;q"]@\c$d /\l 1#U$ɃEPHVfHJJ(+'#+U$2:5q$`E!?S+<6аff2̆bBFUV<6&!at 4u1ݝчf݂:v^mv+;1^}j3^<ƣ˗w&+1ڻW2kgQY5WP3z?rđaV >?+7?}yW1Wbk-|Q[[1w9| ,cr߅ZI n?Ǻw;ݯ:^]]$KoCkKV_'xw p5ؤ `5QJȢDfY\&C y#wrCwxؠ}}vþ<xv??d~jE6)k~ī&zjO8P)(Mr l1JuX  PA 73(+1;k3җ(+!vsnw~.*jF3ZLK]QFU Z!EBnBC}R=n гŠ(ESH7)IGWV7;3P'0>ML/zA %ZQ5q+PHU !# MpNĂer'4##k_"rJe!‘4en!2eb0`He:g1 /Gڛ';z 3Ѐq5wGzQ^̬NVI`9qd1)oZZ(͆*26+U rZ&"ݡǭk%ߧǷ-AiGacl[ [ B^8蝹xKDyٕ;+>_EL=C}UH Y(v=,olQu)IN `Ѥcn~`Mh@1@3RHf_5T6}^Ij@^*i|SL 7]-|%-4|g\Agb}V¼б"LFƁ @-֔ CtROhB#۟"P@/y+{fXUQ+zFUUEYcُع6i݌XXz~=i ӝ_zYE5j_pz2 D^!|%&4O%$H#(uM!}%A7T[rw٣ *<"dB,!6 Cty]Ms4ɘw5Q!Uz2*F1xJXfnC/q§_P !4le?"Qಒ4֪r(;z9"?lmcLGQM~fCOBg{S"߿ qxc/ ]tQ#'ݤ fcqHųZ G ~6& !5( ':2 ۫O@Atswm/v);3œq'c%^b6 Ϗ1uz_7vJK  ĐRFIVnl}A5\c!e1?Gd.6 ϟV䕒3l@ut|6$&% C3hфA>!N@$ GQXw ex nr$L% "RP pwlP))eU 6n2(QLMf&:ul(1bA KWJjomZ?=sGUܷns:>c^j^J=7^l?)f UTֳh!-c56*ÆXku#c֖KUaC*e3Ad)`eEdXA 4yhܖl#I$/񿴼{rMа($5 %(UL:&Y"}VᔫE9]­߅1TIVQepE{-ɑd˸{/c*[{-r XQDO`0[S6$@ K +OPr*(7v3-9anEg~WFﶏ!E q缾yAW@cpr>y}<*y^&-?wMGpAfJ@7[Yw޿ؐՐtNGGşd.ew#˵p[S~; sM17d"2M D6ѽWIKI@ی.6ƌW'~Mtnnfba:xÿl]sWnݺ9Nqˮqn˓wZknmuƻͶs#f.v%4TtRND8n *&sRjPE Mчa2URo/5ƙU-۔eDzʺW8)Cenᓻ5ۜk)ru\)p@@$$@P-nŰEH52)tSDQIE9WMB=EXa(>!1%Ӌ&lLL`ToȢexkYJzSwн535Z䀏4aXkxƂ'U-D+&G칔:+/۱Mܬ?D[eT A>aw]7ܩvBX_ShB*?eCfvū7#,Q-k)ƞǞ& 99F49n)dEr&3 -$ 9 m#Dn6~l4[-Q5P;IQLhi&P,Ҿ#bI vƼ27ѻ|P'WD+4J"dIh?5ѯw"D}_*Ȼ=~Xzim&f4_JB7ʶ-S2juXYazrrQBnqT/|-ӜGEpNE"G(ޙWf17-|!6ّCC fɛ#`I蜉 8^/Eו`ʽI"O-޵a$W7hvf wg@-%X=dS+/bMTK|Ct?B|*n"4X|)ۚ.~s:jW1%v6]"Kul~erNyTG6~X"Xy-G Hf1XDm*<`?tp|7-A48?9@ҿҁѤK=ۏ6)6D~|OP%qg r暍1f OP8ic{ ÏS+;Ghi6Sn#D:rEK'hPs= 9 h@P0|Gr1j}:5Z LAEV` NYJk j.I+x [HK,6 uh`),BKANU[2܇+X֤l~M:r!\+SJxw!B$nfQV$B9]Ƅ܈|Ni]&Px=w7J}b1&ü F& Efø$u%"mnXn4FYQS$^+O*X|y?Qjp-Ҙq-u >{3C11Eu[l6ABE4?)l/V6f65b"UXTpQ$]T)3lK0(t[2hՅ,l01l[|tp*9Tg[47!0}=_&v~AV03&bS3'T|^} %8!PGT9ъıG Pε}HhGۉحր|Kօ3oAfK4tװ)> 6 |٢t$0z˟]d}uޫ[ޭkNϔ,ج!nTٟKvBF7ǂMU-Ty{MJ!!j6ǕIxhܘNxoG)!5x@6; ^"{ejv8"|u>wWّ ͬ 8yQTx5,ldɊv$Kl/JF@9B7 bF4> @îB:tju9ShƯ\-v/}1Gl܆N}5!#Hv!]{01除3qBfb>  MM]7(02(̼krp ʴyV5Kv=Q7\Muc`暫נl6tkv* <>&3Za&&jM**z& ӡ5*F`])eHRaMr:?[劘%A{mc_}1h.p@=§H5S`d6J^;5= [aU(S^+ƒ25íi'/-{ Б ~ jN+YM.XOs,ON|"wuxtbkCjD O{ox=+p)x͵<_ =,y7D}=c >DwDΥurPz-#u>HޣCM.xm&0< q:/" 4D}Y&nDӪ9J䈕: DRЛ|Ʀ~csXipa9rtA╆ѐ-ì9y!m~0ܐ/]'و%U8L)ܹFj ע՗ RJkS25/K+5K 凂}. ,#C8'o!rӼUb/sK>5ds&嚓z~#h]{ėBqgU mtWԹ}jdUU!)Gx}i VC_fM1Vȥ0Ok=ϟ=ȼa mPoK4j fp5`Q_0tM\,:Qf==*DT-hZ]O)žg$j{+C YЍq>sO'G PI\ jDתXxL?:#>UrIv^Rm^b;&ߍQ9yb͂;Ճ>1hZI4q:1*碌'0bܹ{[dxy9 uP}.2$ ôK?VM0lҘvGj n'9LSBW\c~_oثKOZ7ȝMPOHί oW}ГY !&ĩeBUG|0jOQn ravk˾b1O_FL.ECn%6؆{=&# 8'?M; CtdpൺEziJo@z"ׄ[g"Ј4?M{C(mF]&}XTG^U7=TB CG4Ml$@wTlpNU1Ћe~@ƍ })y8$O} u%QmX"<^@Afo@]4z=SRLss496 7Qg__frTtIճG-Gw-ݡoB7uӶBu+*:GZOmν[HI=l@ts=rē7QLp^2sTEr"tR:!JɀֻYgG7crT~t))/KeDƠ}R[L C.FݪЯZسz^mBJ,7ܹ*r542 [iz^xKsJ4EYvrM=+?$KM|`jxm?+RC 7f6!ނ039S] f&JҲջ(XO@+?ܷ/UJ1ގ"^r:cV YZf 3F@3;OȷH7+(EU7L8bPk7K֟ TG&y۬Qea|PqnґՈna dQ!7Dp/.@E-%?*طL.B0n"Kn=#J!IE5/|m- GjbTJwK͍~_*yܼ?c0Xzn蟘ؒ֒p=YxUjo9#ZiiG ܶMAXӲ {N}*1g+qE<:40{78vHC} ;n5O B-N})~g 4Kg9|r.\ Lk~iDƧr[Rct! @dɯIuݍO:<,5vc!]`k?zU:+zr*O#:g3 Z0pi}}jn 2{]o+dCg;ܳ^ŅFҡꔂJwV@UNIlҬ X X)P+dAp>7UUJRN0zW7N13V(ՃI֙A7g Uwdek(HR5&?=f$q5/>GSQx}J!-sCHC:UsȞi=.r|n_^W R =0>tQd $y=abf&}Vi>Y+n/K +8]g6Z?2r 3le:?3oxl;=a&w C䰔7L"yI z[^{g7Ħ]FlέZ;rF:U=W^z{n݀p8Kwt!Exݪ[SЙvI,HlUӣm={ Ag6)_xzgy3Y/h~獙)n &:2b4dEg.{yѷOZ=i jAʿjix2pʼnLFb!t+օFԗ4<Ȭ"qz:acY mK!ElI[)XJX1\5)O9Ѹ'@k2V Khl*Yym m\HsA G%Jb\C*>No'OkIŝ}*y:~ Ll@l6O]s 1F坁:kVE>Le09MV.aBnY-+h`xeL=1vfzYaۈmDMKOtg1'q7O4K H'#L1TRv WIOZ܀[@7AҼ 5wlgpQ%/Ҫrg/7oq '@L.Ke8)ϓypNM jv#Ri>Cql`?R8LZP `AW&ݳ3MW7r 9>KÀ hʖ|~P%Txt7l ~L5}-kMf33ýxq@ex휤'#.&3&f,ZJ92&Yb(86cO@Lޥ}ٳ]&H 'j` '":']8.v(&鍥daX7>ݗRƂU:ڃy]YOmQft D]tc3"M6FԄ3J (|g'S;/ז+Io`KOK?ЌKe7E5H\R3|"BjḲd#& }3lxIp+͖G Ȭ& hjC~`~Ȥ7m۟1x!Ssl<M 0/kECU"=IՈu(Yu5km0sp~]_($r%MvY*$w^7=HW?2{ٿUVU|2zUJTTDJ [w2aOh_#YG7JFs1n!ϹAbi$ _Q$@ɶ[;QԞoxn͒B&`c?)7ad$Ii'k洵3h͔L2+1F$ْl~[2 uasea% [6TACǥ1|>t.'@dŎ|&30x:e0SݚBCTM3C$AJ'rbpZ+7*O 9AE}V:($Ģ@Řg' 4q&]I{c*կAHk VnHђ;z ._ GqklǟijDXF2,}Nx],|},/V`o`wM Ag9ءɠ/L5ع7eI R\\CR;L&h𩟪c!zdc*ʈCr䀾-hd>Gie;M2~0 AM?S0"c3dWC)+GDA*5FaG.>l 0Swm@*ZO#0myXhDs,xd;?#aO37?ЍWQNI֤grf]u2X3CbW;;HB#rf \Pit+(nB4-˜=uտGamK/'Te*]Sk+t/&6A $ݍw[; jO_2oH^o!ldx`)Hu JJ(9x$W{ |MkВ#X'YVfd8bfiX)eC,oDd8#ϧ lĜFIz{HEvv$8sGqҏBIRs 2Fܧz: S/2>f5| 7+w5k.,F.@z.W@PT"ŧ\3kVvTt\&5LדBg8?XLdw u{Wpqcיԯ\ڱR˂+?v֕ 6Vz/i,AZ^x|[娰9†wE]A1\_x{]}ޖaUKLwqҢpL >Q`{O6Y8q a/y.=.Oڕ#ׂ vӎ#[.%гkdoP:&.pB{UN+ x'~t_W :epC+rѨ$;pyω.1Qͽ~7K38lVoQR#5Q; ٱ(PeK2|YvFA pscL."GŬˤ̋yi = H&l_006%a*(r)Vvv ('G$D䂿wY_Tw<zxg}l'KT͗Y|V>v6MڅæJ;jE'&N%,3t |i:t< mq> .o=">6$vYvqe:7$1EBk߄QVk~F*4GN7^/ܧ W:>zt aDQ3Οt1UPt.^+ǹzuߊ.x|5"v_*_^VP57{?^Ì8G*/IhX5:eb noy -Ai.9GHpvblxP!\.U:Wpg4?{ˍ@#/^iu[L84$O pHVv.2?\,S=ԺKG\ܼ[; (/)47U/̫6T=ԭ!c0S)+AEa6oJ'qV=F,L02+QyzhGM=Z&Tx?-ת=(S>R}E|K }kc,p*)2?LS n3"}NQL!{zG9,1ꉞWυ>ZFO}|/"23!:b˱Ӗi8WGY=1 w$d +пb,NP5LqL9 XPYoYGs4FѤ7'qa1Y˚RmZܥmcP&& N!f#Ky…=,j 9N0rlE YߧrN2"`b)}p6S}[FcXd|zx)FlKHMj(ٺ<Z!'< Msڞd y[F.,B^f.־"5_HK({#0=)fѸ%Ӳ*bw"2 i)x](8nc` {#Qwj۫m H.w]"(65:㤯Qi3F;bVNCkG7R|LX5«CLj_R+XؐȷYKס|˳1ͫ`-n{#a/{ Fz]¨s;w o#C*QuV1Dq#(VnzYMiPr\FkcUk՞#PyC*'n3֤R ZG)W`æS"59H?_S%^^IEOZAb3LÇN"gQyłyf T%hAD>iOd>+`ӡ97?** nU-dXaL`4F2 L-*M(u}y6Os5CΔx5*g[` 㻥Qi衃$ ߿UB~dp5K }7Z%c,O=\ʕL[OT> 6 ת1oHǷI-h$K&OlyM/Y{B;k4ے@ } XU=m1V:Ak1?€)(`2y1oylo% ȫ5'cw6I/7Au9nkM,&b։ΖN6ݻ5]B*ugp} ^]xů`~|48'ל7_5:Dwۼ [mQmCXO bxy<͊uIPI\ R:/j줦$xR04myӺ',318[q(f}vhq]X6ŅI"U6n"tZց[o]ηJozt=G1kf!(6.a"IjҾ W5pce2n5}XI*%2LE K}r5s+쁑ZjQ11qLP{oFž"Qht齶rctth%ȓۿVC/LYTSA]I4QཋHnn[B*l;-1)du&>{0‹B95v5fk4M !5U BOTt 6ޚvk33lP,,&vȡ6 dQZ4ݒ ~|at։gr*i`)H"4be]QYb(Q!)B4CTٌݟFyeoVPP4=K ba"7Kuo#Vdn6}kSFwwIkrj<8^齄c$cQ5D h-x l e0]I}wPA_Xb4w = ?Ţ!˶ ci0z(aϯ#;9=:%kceI}/8MC pb YSwz{KUo%͑S R'\zF{n:/'~qx a4/ ɁV/5Vt,'.%["$ȁ.[k)sHW)9ep rz|[DUV65\ii!(Cf7UP)A'e}|Xz4LG>R0Ɠ`yHޗM4sLЛS:fJ'ctp{TV-ȓ]XoNӸ|q52L*MLk7vWjŝݰDr&9EǮ7$Ѡ|z€+ >m.bzղV0Js4~1>(}n^[D.n3@'-0%`*u^ EAt%ӬBN=AHq]Yf=ְŶ^dYm+Qu۱(,?w5N @B 'H)4O&9Ug~X8sramM5Z_3rJ`X7!`а}(Mp&r6 &YA#EN³~c|gEǙeőKB@sA?+R˹nN)D*uQm VdZ6dwŢa]'ZKf,>- _gARwq *H U">Crs>G7'AR(;z#c~\-gd?Tsu5=;?-+uL4zyzW*ίR%Fg<68ВSMW )j7F/*Tk0&D|#ֈOp? m_=x1c}EH}Ku8c.jiW 895'm{e +ؠW8(;:D ϽmpUy 0 H%7JI@}sL>9/h6rX\)!3y8S[uaX|l/MpĽ%+%tQ+JurU,fVql7zFsA p@XpiBp @m?K1O<~0;Dwr>RS]yB6x(}+exCy9=fdP" fʒ$c~ c(}н\e}WrEqO=bWO"wvke#Sh.$'a'[ӊt#jB׮G$,iBKtAtyئnkkʵ8{J.&Pk3ueAy[;G%.mő1H eQ ͏ǒV#(tO00XW3ox|60 mq&ܺcKnUJtHSߛV/מVyz'b5es ,O.Ϊb΢ WD߰i`?Qn3lr=;]Q⫷ wٯ_b[&SNRzg|"` n_}J)2%0X@mJ9ȦL>R0V7i͹#Pni?Vޘt%k4[dI:k/R+ Z\ X=S0҄d[W[ CDAiEe#`I ĎWLd~)| :]TpP^a yȪIC҃\ s 餔ۧ( ].+er#8CH/gj "vhF#Dx%¡'`Y*>[1MGO1>vqxhPn%uemcU?ݍ0Nʉͨ2G]໥xDt7Ne|.'yݳ͙"研}:iXF[xpMƆXo6NHQ9[>B0܀Pa> SB@CoqYv#ܑa Nb/7lc&d[fsT҆4N$yf-"zRp V mPD`\^BIz6=*(r{vg$PF|롮dP a2^({}˅Y>b.FUļxFj\C\veȣbk=]2}M1"!LĊ<8/=,9SQ-K &B V;d25ʙebC)8dznA >Q v2=H/u}Rj:N@e՘m;>ۉGYZfkh{VSYPR#i,b)U_({S?%k{jߵs5rt݉oC*8p Y)N;?D-ɕxaܥgL^{. FT֫ZX4%;BMwwL8,0&(Q_ b_/y5h!-x^[ ^_#}$F.moJH-)A#T9C Ю(QԸ#@%_ DߧV*,w;aϨO݇=a +kܕV_Q#E`CW|_7u}uvXf!/^cJAzv%dgՔ>REiFS}nۿ~_d Z 2q>`ν8Y]Z|frYml:{UB"l' צ0@&}[$gq|mMVsRc$3Oq 칳I5`S7uɌ&l?aQy2on@&ܫ8sZIڭ'ۑ@*9o\`ѱ[uB:ذ\^⛞K`܍#)fN,w 6ѨM&=2>-"q0a0nk#~6lο7bf,1;CMG ZuY*.q)BOm%htռ< L#R}>өZE):DSݯ~!rX HwbHcOMOٟ%t4 s[fkgͩgxMW$ $d_-Ctk%n&[}{%ƣl[] )3v&bNu ui+ۍ{o?6@x!295Q0@9&`$ 9J^+_փ/qTybE]ׄ *V1He>h%re&6)λ9Zj}d1LoowTgPƖB1y"٧`O} {CjI. u7yR_v©Sssܢ>GjO ^W<=`4pB弫eP )H"7}bjJ܎Q*45qWSI|3a뼈6Y8v$n[ iBD?&"uUߞMuVyN3^pC- 3Fx\511y>-̝D* Nq#6N8$>;53 Àx-+\I6g B,Y2̷qm17 za6SֺJ~S$/X3&9;q'm՟߰wqdhoߒUO wlJ #W>xqWq=Ҿ+2ֽ0.64SE#2J?a!Y޴  (N#/ɦSt<3t=S:\$(3I^j&0O؛KXpmʹ뭆оf>o'RNqP\HS%Q߼ }_6 ݯd&l;іCY#͖PeBA"eX՗<=׺Oy 1:fܐ܍,ઞcx֣s|9W8OƝ Ի7x]klܔ4^z*gk=aLLƲ6Q,#$|.6_Ct\QyZ!u÷ a@c b\{B[- t05c^&T2>]@B#VnCE?۾$9l:sf7i*>M`oNtI!4?Ry+|X5ʕeoS2\LavAgl I5"^sN=Z_'(.ONcE4f05hdѬ+(:ށv ,B>պ9>V\ھa9K[*8J:qyn_R0>8fQzC?# s;_EQ4?7  %"f^SzL.^j1ű<7ͯ7ʾG304Ħ?ʫFcʄ9Mhrt%PuMNud%KEȭQτU-Ӏ> ΧŌ"`e#?V`#4JV$~Ĭ×̓ęh^1' tí\xVڿ Pk}D`=;&%|RBFq[I$X!76x cOrdM2c՞8*T R%`le zo 12mJ"! sDK=~?-4(;y1-/͙\H{Yhƍ{lFĭ{?#veZM6 7]gm6Vh"y-ĝynUZ#+WNd^gX$ cBRF= 0[A2 Ny "u.Ap6䊵jHO\{UypBStiI&.^eY/saa#{I#cL&(W[ ~ DcZ|mc^mB rJ#(=eJ|O+͝mȑYrp^<w)6JĬxoO6C[0ᰜcى2^^! ԎgwneAġ}0hO5?(`iI={$ZeڙӳϨRfsh27I6ێs^D9HLZ\gԄė'OPDqrHPf{rEhȆ@(|Mj0ѵ{jW岻v±I(\6$PS'UKQ8ɗGNq%jjܛ{ŝ s@[k8l[ykȩ,,`, d5Ee L6 do&fxֱ^y8hv;xXN^,6XX>,wTBv:kȫaEHEtͿ)b'&F[┹uB bAšQlLܨBxb(I堷hK+r@!Evt;~_\51x M,X K {#%g$ǐ[s VnI1;^&u\%sMz7k[ /hȥ1!7jPV~޹8PE+PrZբPF-W,Rr|`D᎕SF!@ɩx[9qUڥL,v(4k!jm89`/odF40F~Fl\_n >+ccئJ[͉ *?08iORT.h!wSlje EGQ҅%i WtXnblt>ge7nŁiE'\8/LxPҊ穫FH&M@" ۚeh2y lkgRM|q+fVG?/ WxT%Bz~݃}'GGjt[oƸnyB!@![Tؖ|qƭrX!3tw3F( ņ`'H67%hG|X0/1` By P7.'׉r`{.ch>u8BCyb(rxrm >,&l`S{$]\D'3(cѸ%GWZ9ixWTO `e}{  r%tʨ|"Zhlȡ+Ne;"Ma\pj6 =V!r|#́q)yqYF)Ǹ՚VPEZS>7/v= 364 L5oH:!,}Dyx錈,LJ%8@XT*'O%~-)O*{Հ lGI-9fSZĩDd/1LpO"*dEFS4 u rx<=OWN&e"M]a#6 ūB42vZ◚M4p~EkzxxfHdMsD~J1"1^:MuxaM2X"nh)٥۰i^: ^T@0.>}x;_TQ{f o_ung+} gUUD/b"FuWGJ[uKVJ/R 1y{IE{n(sN&@Pɠx9&x4">F s&Xl 蕏*b@~J HD,R$ V(t2XBn7 ;HH忐u9ècbF?a@"տ4+0&u7݂+Wc Qz B\v>8*zƆ,+35)Xϻ!ɾAGm־1Y>ێR@[DW~  s/kR!"c;;ˡඍ. iY19a_*'Spzm(2Hu@߆-36TW~ >J^r6Hq-]yk:SA)oefHzId΄AZM`K@˯iMRBb-E $ Ȣ]s]rgL`<}rՉl6ͽe9 뵕鴨<'5Y^ft b/eKkLQߨ-~ 'CX݄7=|\& 3l\;煩^θFX>/v^Q'ku/JaP &3^4T5[;V*e#n+lXhҒl~\t~ݷ(F%кܧ-;BƎ.퀣O~e9 GUnVDwGsU{%=/8ieÉlRYK|X-cnU*31p\+sq&qaS?FgbıD[P=7DjK~Smu8ZY05:]<ߓ<áV;^nu*p; 5'B:V$?iy wΟ f&yxX^mNQ#j5l͆ S\_Ϯ9 hO"B 2z^><~;8|Qt17e !:!@"?5?O}\m?z9k5%AR}̽urx;h>kuA?FZaDN8 }'AgI'Rpj{%77Q#l dM{EQey gvΛUZlOɎt#fxcLMvXXL1+{$5,|ֆS@dHPR^}ƫ!/~򹨋D]vy4}tY.Cα>owرQԝd+scWos] QY`WKl쥸('&E~SBk 2saڮ^DкO`LST8^Q~D-CԦRˮ$GH0'm䨮I,h@p\^$&5->+D~>٦[c1 ѷYEf%X*N2VzL=HU5P'*k(De^IZ/# ld/(P8{݈+Qi+wT@kػ/ (=xOD<䫫5JM2fgLj$ d䋝D'{S0i2P)y{ 9c|cŁOJ@)r.S y rfn Vݝ[d88/-ZP ȅ4,A\%.Ճ*wd}H$L/|D}aNN2+2ń j@ xĬ6O7/i־Dؘ{Ps a II4L\}h#GF -e'Nk! Q1j!oWQO=BzFE޾<~+iB'QO$n']Ec*C dr2G1+rc7\FVҼ~lY{1{5=ھsz~fex|!W,.]W PWNn9| ör20 DOp+SqW}oIlҮk7^+ń*hūNWOCU`ԻE;bȊyWF{ʸqBah?Ck^HI6D sc~:M%;J'r]TL~ kޮU2Y,0zpÃEIGZ߸JםiqӢH{m!6vqOߧ 3r؅[; #v?6r{a ̇9 Wbh`K1\+{ͷ~5&g KғZUtݰOJ-| BWf M[}$'@Gtw/x]RB!IݭAiUQXpsL 7x:xؗe/Nksd:"kE:oVWchTBT{6s^Ԛ让#R# P)$ntZYB!QKepIT+3aHz0(ntѨ9~OH~ oC<`b; p Y=! KheRc;-}P/?~|QJ0 ~"i)$ ouqӞ|<p͙ԓ#/PaH'PBG͊P'5TX ljIm \u|- [9/ !3F2ꎺ8e2yGc]' mϘl(Zu1qU#f5P9_.Z6ў^9@W'VvVi.V؀?M[WD̓Y%Xu~f&,Ձ(ˆ=~oZ$VBVsqHn ?n0 k( NsOs4"]PM9^p d刏1q=umBȡvqb" Rg Luł쁬 TKát״C1gۣHGӀ #"<5gC,A{TJ%h5Ra(꿘ÈG$v[{k@WUo8Ak 3 @ t6n¬3MDd愛_\`&>."rj*R(l S$f)?;}Af8i:{BlkEffd[ط52PvShD½:|%ȜDFn< RD#h*SDˀ%qf5zZk=t!eX\|f%ol~eV&kpyJu@(Ib?!HPEkHJɢA58~O-lW}_diddRbGObpӥ_2VRf(9md$G@ vvcIk55L ID Aîe-ĹU5 9Ae["\qK΅XiK4MڽѦGCyY.ST șJa?Dv~-vsNзQMz# b}ｏcT^D7T'2"%M*oҲ* [StK2nopJrCOkRVx_^{ti/E2)uC\FB^#{gHwt:񌹣2PuzA^ٮ='  SEք=88De6reBN"M+gi0X0$U\}"K7<^1GDqb{p&G0߁ _;}0ז%r"wQzYN/CeNTu4;2^sDH>: ?HvXje%IK=rfzBۺTz YPXoȹYK-ȕAFhc8XuVC+U;d7>%.O8N26;Ea*l8(KOE*Nƽ*N0}>M8z;xgy,SeNQX0NN#ҎZhԭ/{tg~nĊi p^W\~5gc&Oji2͢FTp-bAG}q'z& W+9 zZgV+M]A{KAHR1P͆cf0\k Ft+=pSH`[ qhS'3l`"SQ?{BkEH Hi .ȓ}9ܱU|߃HV*򯊾$Du^Ua|N\0c 43!O[URj4Z!ZkAL47@襇ōì6 RWJe5~X-HLG5p?>=$&U+?DwLjW.syr ` s7- 9p?}>O&Or7j@ G={gmB=ZPlsрTeX O wӸ(l_i@_55[d6G7u2N~u${c}1V㊷"dv $*UDe6R%e]TC%D2VS3ڏs3?w5_hX%-Yܼ) 0^Op*0xz:_nղC},r3K׏ ?SgH=(c4?aO&Y'Ƥ %;@M7K:,4!l*\T @<@u`Yա4 ~@وBa/m~>|v+g+/wjhyٰ? ,XUG~ ksK?>~B^Lwǩ6J7yX)Ѳ&l ZU;iNZy'eZZD< S0jECn~j0??z @&m6(L\=)QB\MH-p9+ܾ! 1୨"q#P <35}%҂쇭7/6 wEh{姿K՝+8ZgE(*h=P&WI9M j_|f3 0]>ݬ?N&SD75JDj:oN޾n6Q,ڸdFSDW+dw3>1~LYaQ V&lIݟL~Hc\/qf04mj(LofH\͉BP(j PHISGц%~܆i\xqD0Gv43lb5CJAӉC鱴{ cdE`֦ w~b?1s"X/S_QO3y.8S5j&XHb5ɗVI2t4' \mx:hJ;t#=IS8;UxRU2_d#I1*ZiR 1\M1Y**y\fݢQOt!"xd*,_V߻Wbʛc4{Wp<xhR#wVlzcD`0xk VJxfPV <:VX^nzbr\Ⱦ=lҧ A+vNz? bbd~I-똭+c(B Ӟ/Yj0[fx[vZ"FЬ0bkS+N:F$l >hz6ǎ%go(ڟd/e 8d]Xn{Ȭ~X57%/Ux]q0.mLT. C a'pw$]Q~ۻ/][`$z֕( X 5SB͔Za%W #_Y#ՍIҖ3OF#kPWR&# ]&!~Af\ܝa% Ըj%# RL>NQH'(&=toK=c62j7TgEN2RQFȺ3 ]XR:1&7}S3mE'sIխJ`k5!P{ONI웛aTUdg)uy;"[rXHF"=#JAShAq,RAy'G`gmKs 6BOmT${O[矊%ڒd1,(U~R &A J aWq׿P/E1bAm^9̵h2jD05/vL @FZWc/?G I8.`j\xW+`VL-ovy!Y 4/ANFz~%5t1\1+i9mٯxS/J(G:$0\lbq k'_02Yg.Ќj48{aG3 撠2?; *Ɠ?Mp>H8M:F) 뙂ITųMQw8 wZ %p.%vfXdV'u.j¢?׼W'v ,zZF7*hLZs3HrOzG+ʀ6=cfM,A0 BEG:гm-~tJmK'`uhl&V'a#VY 褥bN|_k][UV3B& &U]G)ǜp}>fxʥq8~.3xXcb&:E"wv]39^ 8sC[7q-!wT5re[W+1KLT+9vu &S~k:;kU:E֡+J]g`J0FJWwtRp2a&jf+{ET:Y2bH9Œ{ 𦫞??AMcXZǝI wEɊM&+*coܤ IY!DԅFT1]$o F/r^6G0fɶ@"5o-y#kɈ<&ӷs D] ơS 2z+gG"T{E?E*A"yf^8Bk}_ʧ !!lL%=80YzYN~Jpy!+8S$|8:S],6] rkQT:n"O\z~B}I-qnk`AR;5LaR\LOf>uӻK%pHKL"冗˃2JBQ_}jHf٤=Ega}Tx5L`#Ԛ6`Z@J$~1-)J&fBxY!FE$#H cye+ws-to \K/ф1(Һ^[#xf(8feTKN]7 {3z>em2LY] k%]|-HCݞVq_ﯖd[rM(vãC: ̿6>M\ަS7#+i RNg@ Q6sz,#1$W߷9@ªΓ]a CXcHfM$XR"GZ`cA$sM'=I#4A,Xnvb5Ati~mPKlwź_cKηSny$FW6{$T?t''saХX?_ݠ|ϲ?Tɵ#NiJWDq7:|n~~Wu<&5F/s1 A8fKUE[0|xUē!>s[\vn<ؚE4{AvnWmǂYe hh?P#oc,#_oF2y=xY+J3[,\]٣̈9UAHj0o͠_% X~,/ű;Yªmxw{DpNYT¥KGv[3TQFgh%u͝" $)T[,@oR6YC7Yl֍4C\ iAS{+@#'\]A;ӊ1g?,F!h҈k!$h KvB>|xA"PtHX.Uzp l,J[۠P[cvxqPqq1ru#bdp\[B=L'NcBHm&"މ/b>I< ދt*bO@}.Wb8.N;[bfu!΂%) oh tV?opn pOG?֬uQ$-V7ObM-g[p$`KYH{|$QIі9*2n%y_Ǜ_sNMi, #9}jZ*@&S(Mh/)|o3ބXE\J؅\`o9fc 06੤-?N]脀)$ϫbb"ǮMȔP]9[ě٬Srw3v}X.vXM(r!| MFx” J##9cFZ#\,&VP +w3( 9N‘(繷䶉30g.t{-sS"wKNpۤ <$ w)j૰3dE!QIJ IhdorCU-z4!:(g2 {eTa54@>TVnUV(h舄`Q$Wp84#._"Ĭ#\| z%5( JzV6XvVdd_=TpSRE-7ڈ*zG K~Rm.^4S=*9/lnf=ʸ''::̶qWvغ!*/7O"ʃr Ra m]M6'fghIu{a`:36LZ<zMUIxdM ̰\['նO]a"u8qON`. .E"|0Zj]ntd ļaW,dpX9T&JH2=֏VR `Y[2oku3N*Űs>|Ni#[X(pnE[tOg1Yb)p$*jl~:Q7.JH)Ɣ /q $jT']x"]T*1Jїp +5Jnը,%>K[Ag'e,$ט,uTwF3N?E}צYr;ϰ.Nh)DMkk)sd )fy"HUMHVfMY)AF`J:r,joys>}c\m[ OTb2kdt7-p6a*8 z9[w#y~>jdK{ؑŢa p cėsw[l7nSaD;ڹd+Ubr'B[ 8{9ES*}⏖'}e( a, cZ$'*yKisM&p)CbR,;.Cؾfу` ^S1M?l H)$i'EKRJ2MSFx|YbC5lQU [a#9gĞ;v1Wn~HTxhd(в?Th^nQrf Y=f4YiADM*G Xm؅`:1~\/h3 %"/W!4Ѱ1TX ^ndg2z? tҭL-hM`s;5@Ʃv\LUH~ H W֟P'Vq+4~Bi8T-5+A̔ y]Y0R`6Bkf7/ (VՅ㝑9tbE`6gH=rPdu-KdEm9x=.du2ӗՎ_` 5LO<@9:7|L|BUz.W6:yқl!|P-ʟOqԮ@:হc1Ig?֙|<nS@1D Ju+eRuJUNSi*_r ?. y7HlXMCzS;;4KHFGKۘaq_.Z{Ύo.ZNQ߮5dtZQf Y̑fȍ-@0SDLv9ÝU3r՛gȶTjg>h<=,\Sr4Y悢4M#kۘ%dJ*LQ!2t! g_ rW{eIv:TE Tc5zTb>l! @:K F5ӝǴN 9c鄟`Hە^Lۢc8݄$/0WO%Bq 'Nte]=5@7W~-\xȒilvՌKVxd@ ?=ݚBx ]}|\9Bv*Smrx镻\薖pSSEɛv6uZS/Lz "bdޚ݇aygNLA:83X1Mo/RXY]Z)6^vsW*{drȎ(U5Hv 6]>_w0f|_T[2QNe{ʶZ*P# $Ifb :2E'@pm=E@)'_wPA[u £Q2gχlCˉE̦Z`7~7>S 6K[wjD:abJF9Ur9פ{+Z_x8G*W ֯6s6qcv ϣ {]6C_/RכW#r/k-Y?͉hz 6ZE.,HH@X/KBĽ?B7؜P!)u@[AƜʼ؉|!^9r~+kcB_Hl18-JºoFHBF#iqtW]:.‡YbU& A>hM3㝎rFd-u@  ^,I#,/  7DKؖ^6#WoO|مS,&uU2=9m!6~RԘ)g7WS*"u U㐛f:Ԣ !=(ot"kZTaUsw[jҍm\ a5>-=0!R!H GP|k<7LKl| U|c^c`B'zԱw=ɫø&P fHCެ]:!%gag R^K[ MdJc$V%9/Eb7;q,bfL%dV:ςog5|&. q8ŇҊ 8􂁢){$ r0jca.4e66=i/[!ASKiU.dw _ #XTʀt2ad?{uZgVF}BÔ⨽g C©UDM0**ݞ`rN*o4vK|'59;m3Etf#T7ϊqBvv 4ۛ(Z$:ӼՊ{~'e6,K?`a40%'d;xon?@5 aҽ`ڨ2Y]qC F`7%꧸ܨI)) `Am&<qpMGa73)8a*akk3ݚ+ycuD.62E{?5 Ҳ~~l0IrFʞSc$y*N Bō\bh%G$^ILÒwH ';B~,!5 %CXX+O`fhl n(?@ dҐpLudW6ߦ=V-bkַof׵;1A#mɮ w!"9>8KU7GE7p9"S;I1dx8yt\>c+;qB-)DIh$)!\l`j- ).{r#V/5/!&t*qx}?٩AQQeX׻[\1aKr%-mJ~>O:Vʹo횹&\=xXl%[X:'˻dzUCtXh ;No f׉Nƅ ԺIklG0Y1KAD,%;w#!3A:)B 0 Z'z(Vy!5#~y j _73rCvY#JAmyuWKQf(N,4zakވplf98496g!]LFx2k$Ԛ&k5jPaS}KXgsv*FGrRrb1Gگ9a˹K?f(lR"ebugalVJ0 *s>[Z!]\6ş|ŗ"=d@^jSXA(wYk'`(_UMsf;|l;/LGO l;H YJۂh+q, q(g ؈EeҮDQ[!Oρʈ…g%ٺkRس11QMmI ~A(i EvSú YAO@PIGc| 5:Ӧ 0*҃ϗN⌫ ź f=fB% J#Gm2D9^8{j1^ut,I|#u-rlLqv V>?ۉ_Wl8뮎kGOvYɟ`d@~Ft4V7R z'I}6)V{7vG\ӠWzhQeJ+&0:YݰG? m+S>^9:تU_Nj92Wp#F4.Y̆.&1ּo"׹?:%`U jX~`y4{yq48v%_Bbmdh3"V`tصsՇhcuUcHCz0 䚋5z1NƐ].0O̬<"n1[ʴl*DG]YKx:<8;=E0\FL?wܜH454l94TզH@ǩEis;?Wȣv& Vǹw1!RSTv]2 Զ{U(+)wۏ鼕?ljuN2>bE$p }N:h%5lzHR!xp̗:1Nvf@(F[~y*kR7WQ[_BA4X80`BN|&? a>KRD)ɂܐx\X M_z]ڻtU@v9HޚaœT%G<\ ] %b8ۡ[渫([ԝ5g~ΛjNPU{JRm+z g(2/x6aM8ne`CDPP3n=yg{s~Oezx  wH{¼eBxԽ:g҂.t#سqZ8qִ?qKCqFܞi !里X&3d!"[(xLRBy( Pao 3%ܴ8'~׺#8Jvij-LM"1MZ^dPl>Ne^qJOlrwBZ)'#/9LQ98V$rY$2dR-ODtsӬyЬ~EYR jςRFCQ&lHρHldhOu$3gRYlmt%cɒғ4=K0.ÿoǮ6Xbm6kぜǁ Y[v[؞JLoi3`TW7A|jXI":ѧ2sh_` 1yb܃|c;L##e֓nSG%oq5RR9$z<ͯERWb ˁ<&8[ТG=ׁ^ZC疖pWUZ|nt@ }de, .*rU?N4G,*$jlw{-hbFeA&)Rװ4١Zw[M[-__', ,>6\s?$:v%c@6HV)(kj?>o°)c i莺q{pG;Aq]Xq_T> ìkj;~RF/S[qAJme)/xӉ]!6٭7[ ۅ0:H *ħs jHzMmu!ari"Ez yh@h9* 3p 3heO=0Y˃,K>2g՝t]&D_oWB7Gʮp_,zS`H;JRA")GSc󩇌Ȋʱg_@'N`,ۖWsro$JyJT`m&vS:MdHc {S0π4s{!m&;` T1SVu3o#7Nﹱz|WAL-5+Z+m GE\D[*VְH"rي9q *̿ _I>7ܭ/5d;]f'*tj{)Yr[ĩ~_2G @'aXOwad,_[qOn jKAӨ,mDktPD Yi`SyϾ/*UI^)W:L+/?)'4#ęϿ w̱?KaZs =aEx;1fLnn@P1Y+[=%[W0nlN@g*6jo21Ve Zg Lqs4#{fr(ۅJxÆ_3hw ?@ҮW*鉮FkȢ8N p"dܞ ZFG^k!lz@vBi>h ;)X֌c-B/Q𶮵dIkVr,':(U{kMrp}2Մj'0X~74aωOgKb.\,>fT1&F겇u<nfF@|g5u=l8S` rꐱfq2 b8Qhvז"bs3jBl|3z%ksciVm PޙVv䦬hf\z\W@&a',` E3*f?F.0g^:L:e@@(ˠe4o4fl 4t"@+o ')~Ұ\($CZP;j6 dU8"SLTlW?"Ȳu }5C/ EOK$.6T􁛵43~N8ZaaZd׮| 7g˾^]9nH4;U? Dz4 otpъ-QG@pB|i9Ƙi*JoUҝXO QEXʆ Inhp^X!B`vh+ ~/ d+  `˶(]W5/yt}qJO rXØS5 #SZI9˴i ǥ*qxsqaw\Ȑ`Jֵٜ+W c 0J2"~4ԳP#f;VꠕE38stY$l_}t!O޳]]z=,@FIքs-[k1K(O,!}? R9H܀ȫ;24M'Qƒj>g&n>xg@&ԧPNP*2iMZ>|y(Ȧf'v4EYW-|!Z:D6@׫;y"3C%f֤sSձ^9I\0/owj+W6/bqXVOo_2I$)/?J NfxUTӦ/.9->0Ψt6A <44]l*#]A(9W{H@c6oD (ɨv9fjP:ÅJ왋/o㟬#p֜KN֣HZMsA8/f&# aZPD7x5Sv j2!VDdI{#t+&Uג%o͵TzOp{HfN~"Wpbr#S> m'kΐEG{a\FEcݲfk6]N5,E!=m- NpY΋k|r:ݦxdZX(S7#{.j1!0V#]?.ܵ0l >$/lO d^I}ً^W Ӗ d6J=:)"jǠ qqG\Z_ƍKGĢ'ꬔcuE(c24v\tV"}dY9 >25>1'/4BꍡI7͈_`lMAfG Ί!!i @8-sq-^Bؒ#&ъ)~H+T1CN:g Q!C/5F=l ۾s9g xL6䨸l*)yʫklؾĺ[7nC ET{mzNS(\T& w9''SQ5G~:,X~sc+7~IuLO8ӿ^o2' L!^ʯ}=0=nnnp`оZ6S!( Qhr MP8@L]DžW],'yQÍ^\g{wS@k<`N`yUٯN&P^a $~KZSVNܷ=IZ zIci8bd+$>|G9ilÕx.f# ORIcڬV?^Ry̾>2R Ta2j`qSn1IY7l~xty@?7ջFDfRz>9%@O6.#,̭.h ~\Êy[J$۽p(e`|.$Oߦ9%|5>#gVNb7m/T%x8:3 lR}O(rG5vޢZzj] H-jvIlH".YQA@A%{w φSO7 TZ/pey.72"9C'~: #Q|CL)x&: 5,95F_HX$~ЩǏq-ʁ|;5tb;` 6EO`O!dBT:[ߏHpkR;!tGVn?COD Z~9=kj:H{[W-J$w>P+vW`cJڳcM \i%u(-y[yϟc;Wo.=^. =5EF9K- T7Bۦשzܼm8FFċ|sRo /Mtށ{}\J#Eo6V|t9f. ͉tٜKz9A)8!kֆtv6yp΄k. j'4L2r ű7kn]룁7ݔ 䋈 ٥*v71Ɍ;DisaTxlNsÍDCh n=4 ߢbTS Z.l7 ,j,_!#ݫWdz'Y "=69B?0ifBy@0 x@~t%^(DŽp"J.fld3 ^:y3z)3%/7/]n|wD3)|/iCE!(1wt_@t`P:DUԧ:k+XM"QSfB;w4WЎW`z)!n/ )P&xB^<˺aJIh @2渶mlƮ.-㥅+yzT$TܪFǫ@(g\'xFu}Y"\USFey2AOi|bˇp kbut'׫ NtC$1@V۞ UbJ$ŻNneDLö8l4F_zGmʗQDXAJlO=3~BBݨT4fXF&xJ=#XrŖ=0W~QЛK2hTegI\H#/mJ,ZyU4IÜ%*d*laRlGP\JB5=^0؆2 c3>{.HcK ؂nڲS//M~lapzU ig[܌m'L ]81%Nv?fS: #Cs2D~zzGy9[s{ѠWRZVE!:4. {뀑jtkyg ]!jJ`b&{o8~[U[}u7_S8z#?8K"f [/OF)o.nu׆5K*MtF;."ShxtPxAOF0jvk6w!e,dp2>2c;ZXmp:d E_:M,pR~g@k߭^wZ%&j1jғ8dS3b(UIioZ75UmE&M*h˘1YӫrfCz?1O[ _K-Zcith1ǣJr7!Ѹk9$] A$ ղjglw. ~dX-Sbr)\y,#F%ߙʾ^W Au-0Yu f[(g)L@ȼ$炈aP33[[!Sd%j:b7:sHʼnA~o#~s(c.4s8O,XBePZ*݁ 'Ӊ3[ߤ?Y}PDLJ O{UyFRb$==Ofk5zߢJۼŠ}aq<.rݰ, >cQqj@1 ƵJhXжLFhmgxggqP~_ (>Q./J:p9RWSkHCHb/]ߘ- cl}2kIn!NV QU D #zXkto;^J $ c$k)d>l3 29v2%Y?&;yoj f(!ɜþ.H:_[Xq]e/t[%Ei[Ƚq2L+n(©O; Ȫ !j/VfAI# q0tbGCg&@wEMr++O ŕ> DL7>*>XdUqw ECRy=cކNA9xDF꟝x51bwۘ1_W}`~;/F3|&ێ'HG xG-TS ײ&n4,g]^OWۮz4\Ac f͞E[+_.^n28?q`S8)I:u-p[ѳG ?6bȴ_(yV|P-ʌ[꽲+.d7UXM-nXLUgF-{m'.YR/ѓ3UFɘS:)%+?Ix.8\b $Y6,{QRך->qx{Ke20)YNw=2guRzkdu_oRU5=zGhg|oxN8]N-%6"wߢwEQ*-ӱ=ަ"G @k 4aBY #2T_{[uONJ﮺kBچ&B??oTPםlY y&",UL~`-ŲD}bϡ0O<%C n$ ېnyn0l{;+ES([,c0+_rY8:l8 Ǯ]H c*%6\rYQ__(X@jhԚ7,ؿD3=8~ړ\1f zg F[y6FLdQtmrtL6zJ3҅Mކy}@ޡ8GHXh% aC~{VtM"NSa?4z#U X,Jি5I-aIbPsKܬ*L(WUUƾ2N[udO&Qɨũ&w0BڍrJ=H* ʴYP?V#9)Uۅ9m t2:2eOgлrz`xs%Oq"z %Ixn4;#@.ѻRx8 9i8TSz`U*ƞ&eB5+"`5^4~V!:Kjk7Z1+qf"8Y򕂤7d22"ʧ&@6/ѭxh;h1eUæ3!q;6d-|cHm 49DgWgOP@5|(әz'Ff픃9A9}tӈVkFu#7OG\wg;?C&fVW;Bp_u|}O'{dDUܷᨥ26kLN$m]<50d:: B 6F&U_,^CӬA:պ6IW+)l !((R雘GgJUbpv7VBQKuʼ X 9dP!w1] c5p›Mx|[*cjn-.GM?| ߳yMbWϖ"dO5l(9L$S{]?ר$֮әЯKf<\GlBڨB=Y ݆G Ԫv 79ŶtU7WlQl('%WֻO[o΁yMŌx9-$Jl Fg(| X's cŠLނ&Hi|lZ{ykʹh$LY:~}6̓T:q ?vl)VJzЌJ³ǐ.3qew=|J{}X sv C=,Ә7S=.Af@%IJlZQtԶk`&9VnZ}&qUw M>D1eRaِxV" ȗk5.:$% S|}ܾzJqGG_IV}ɥ̀ѱ!eN.)cDhG he1}*@iж9EhQ x| dInU*iSM^%QZzȻmg;l0_7Te[NN܄8" 4}l@gwh\v~x 6s>qDvPjN8Xr=/[31w>USR-pLq6D';VKH!H}i Iۜňt IS!'Ǚނ}5zYٴH.~4̕)~ŮM DYHnbjVPPC䕛=$׼n-BY} |F]p#nLO`4z@v2}BM(- Jfg6|E}Fd+[rt@f\BzF_ҭgw" Y}Xl4HHJoM̒~']kV@&Y?+62Ť1"" Zy!^ϔΐ[We()MVRœ/ಓWZzpٷ[p!hW#n*bP;(oI|׍2օ@%*zp={yi; ԡ N]U;."a@˼OP8M8/g;TOiC9u;(5 (7D?& +a}ѥBJ+V7d\O]Ӗk#0XP k"@-VLW OOD&=ίrg=>L漘 -)rS8 LY`4% o,ȔaA!DIx -r]HӄUT )d,4-0L0hj͕1D  >oOEL112χF ZtKEL<DG\CèȢAıPL4|/q98i\gg!+yqE_[5b~@ FVQ:cJy6XbOv9hvl:eA, YrB<DS:AE;^55I9yh%io=?C_ӴZưH\M6ӂ:&/vZWciʱi>rl0dj YE-Щyͤ/ڱ) z-Hhr3kʆA쭺 sؘAQrVWvn'D*:>uS Qsv6΍ӶvKZ`D9L`(xg)d LWL-¸V'8hSԽ(&ТeЂ>XKb))I9Lrx*3\%|9Wb~DenC46vkqDf6m-TʘHɶЩ(/ј;oY>fdmRs-85^sN8ӄۊdG 8?X ǜ ,}RJEh>xT0[_-RZ$xW[a2ty8'SZ0-] rVs}DskNYnߕ:]9euu{Qi~$Z!x@H%vZܻo{%MB-v1K- j ?Hm^S]^"BY9hUJjiJ| \8^ۖv|U kk|kXRm8-HRgg A"')v~"X]-׬xM?!3)H pMs$/ VswO}CTc Uiƃap UM<8 n˝G;,`,tl Ya:x:w2wcBs{^᪛l#|`;cNTzzU9l3g.s h@$'U_W{j\P/HQNq$woaڗ2vl9/˚*!ӝ%Q nCQ a{gs-l|Ҽ y2!־;VG*wĂO=g5[޾ӛh=e\8bg]$7+z&;Ři5<բֵѻf_ٌTѬ9져<\\.'*ĥo\Pu>-h/HǯݲעdTC\6vCqѾHZ>?U8FÂkKy&~ %UypYazEh)=0)HBF4.s<~;Stn+4̪O,;Yr)LK D\Ȇu0H3TroĦ>锦FPf4&:% s\-cqkfžmx}&OO.O坴a2AdqQ-}JG &Y&ZM6c.\ r(LOe@ q%?s u|/t`m\SvQ<]'V6?i  #,V ;F8X. ˌ״9Ɉ*&,a*zF &8 d튢1UwE@Pn^Tmjw$Y9qWT!xU*Pc=Bچ Ԃm#dzx7x61P}1 t wmysjWfi-?ݬjFU,` ow _?ir_[c} w H[P2Wߕϣ}F;ͫK}R \]Qּo/B2\S ڈfUX4y q`@]SJ+s @Wͯ(AE0$l/8m!],PPEr3cy-ښK`% Cd~"VL0~i/q (9eZl&ih_@`FGU@'.QQ±څϐ M 2mLN{m7(RpaaIK ǂ2abolh$ꈏ0X=dSTp&2, ,> :2w}N՝̊,/vu}U7(Hޙm?;h%'d[<3AǮb1[ r*zuvr:1 8q$~e{AFkUYJW맛p8.@QW"./gxb{=] M]- ׆ihUEՀ3 :Iz BYПI+ޓ[q/M3"gZlm;>(ξLn~\5`KL{=tsGb?hnmJM6sI#X u7Lu'ĐMW1{!M@ؚ}޶)+tz*^o㴗_BgƍcD<;[_HJNC'^df =V$ȚS۷= >x`xWpyH^*673$8AD5E뽏϶SӓO@fl"-a =v( D'4}L6ՄiW绔n,6Jlj" M3h(IΎb!< =vMݎ˃ICC?ØnT-7%Vyc6c\ 8WNdLtۂ FC>:(ڨ5V?OҞAZ[28$J#7(eӼUԳk5;CZJIDإ YA_7 ]g?acq}b6BLE~T=ǪVX..7jl Ѝ3{E[Du=7h1[t0IE^_dUe 'R禉2Tx@TDb B-6Uv-PL]S4o؊^a\Qr=Q9UKEI' R(cit ATkeupPb@?3/qʳ3vn:yHcC0K6g}e`vv hڍ&Qh\G$c1]qA+oAk)H1%sk,):`W. 9[41.Wj;IvysAYM$\xg| b15"|n|˸e} <VS>ă;m]S%n"Q46Rr]Y1. ޸* dHO:3XMti(X_dִ4Bqˊ[A"P>~ 1? ݌:t*X.L4{NEl5k::0.j7wI?8w$Wmk:9S֝ &!l cKݔR!ZCvmN>v|n]a/2Ѷza7{ޜo}_kX|&06OBkՀ,%t[qZe2ᵀ`a4(9-lxr8SiHD@f{^WgƳ1~ܭv ~KqY$| t~65a#<ɿN蔿k?^L>+'2VŸaeҮ\̻yWE:j/IR-楎W!>uI]8[׉ , 0[ʞ/7)eHL蒁m bhH,H7OQ.0ÔV؈17ꃟ~t8GJ2]#°&]&+rU(%w2.7Dɖkjd =DJCbfNnhd/h@;,# N{Ȅ3!0ә3h&֖* ` RD\ rYs_X\kDV-d*(]J>[- ",Pgz]OYY2klKۭ4IWK O?~hhwG@騻r?GBt΢^^<>_F֎ W|T^2wtӠ~FAKf9:,Q=FS=X}vNq )[4M`#} u=EZ` lng}Rc8l~Qiudʣ^x#U!.ڱ1(6Q~5 \u݊ _$,d\qju6JCThja\` FXb>Aqe1)9 ƾU_A߲ poW617| 3yN%:%NSgĐ' >w6=C ?+#BK! it 45jxĴ9mPQy Pp6"pjM =Y%ٔ~bc2HW:ۼ:]l*ʟuK rQ<؃[s%p}xJh c)c_{_~y%ƦF=585iYz+"3[l;Q}ɇY{:QjHzB;x#Nw ;[oO]W# 9qF p*5e+B kg21|&\GG(2o?=T BimIޔF>ɢcRfdT'f|?TH yШ{y^~=[.}'}7 ߣH;ϩ~Abs`<xvx9Oj[I,]C?}?.CkItv"ʏAב+|מV!&_&WK8qr7xtwϤ;e ~y4lr= ?畖 (>aj2M~9cdyp sORsGTfQCnf˦/eR8?^*J|sǷ7W39?@M|@]yDӾw|.|ѫMK(O8i LeJ kG"PpiƤft9x{WgWHS7c/Pʺ;Ȱ9&Ymv 5êM;υ1s Y̎a8A;6JEP9Pɽ4x,>WVDL8uYs2R#('a|ڵϒc2&̙j2B2 هine1c}ti-?ҙ=ҹ;0|OLs}TU*2,1Ҽ^>al3;Qm2zSȫ>.t,X-Q{Cl 0712A@2)b5:엞MfH$2u CauͤV KcHc;u'Kd̊b'Gx}4 +C,_iI.jr&RAmjk9ÅLmE~-.$ wi'&M9(GOL+r?ˏ),=Sٴ};U|Am=$=!>")$ jH>[,jLO k (7qj{jXncV>sɀ /P2٥"D- YT!A[K@O?6*4UW1l2 :G'jp;jW>f2# XĻKIgMHpࡩ7$W)-NlUUhwhyRlmrB΢(bTq v$U5lpx:'x/w7s:FTa0ؽTBi UTclU܃12hu:LetJ8ih?-Wx2 G,霷LiS샲 E\ob}2r'ǙB5$y*Q!!;mTwxDx(SqV3?QwmG0.\T#n k0&Tj1‹o3 F[L s͚ W;ݒ>@TMՊ 3Q`Ď~AhKåB"f 'ͽ ONyq>}_| ^_E+b{z$IIK76ҍMSq,_U^AE| nq[H{LvpX?xJ+kd3SD.*c Afs[1hU)'mdPxgl5;+r% P;j*'}@"_v>HdOݽꅹIIbZ&y]E;mct>h8?C"8' FȦKefc(5M!)YUpzd4=eދgߌ/*a jwP@|G?6R`p2M ũ0 o ],Ždženjɼa#SKgGOfF[q,-fιܻ$.6)H/H pБaaĂ ~;.yJ o;u<?'1'(7rIdaۭy̏b,lw*g > Yuqv!Uz/w3cdGmw~\umɰC`^}[gOU51ݝDڭ*F^8-0B@֘uZYtήޡsxXz3װa%^fKgpðch/IRP+51ɅΘm4S7 PSAq5Bt S>Ǩ=zȒ+|o0x+szQO-%}vϥHZzdP TnH4(h .3P {@񬃸gcbDX{4 Od^E8+11CDAV,̵ N2((Aa؟Oa[[ąߛ l|Aͷ2+-/3 G/ }Ee03`8YDܟE!P6Vɷj9H[53z6 s78+5oB@P`CIs V`& ""oX.6֊ż$gR_ ~=(&~g'rj]3Gnxj@{2=M!!v.PтZ]֦~̓6-X5pٓ-w n҄0"").׍D_g'&l$mO.6x-yE_!93"*2^lt+7(akc(,X6:!V%-}<#RHvn0(Պ꾅a0fLVw6*nf4;XV%4fY'qjsĢ/ٛ-@6պV*a @Ҟ]^$65%͋ms^PXIJuSnR'κbr2Lsߝ:1Bt^zK3{_-NfߌM/[b(0W\<6[_+ηgi*wgDf>t-ֈ-aϨ-$$oc` t) [8xN|AE Gg_ik)AVRi `cpHy=6dFo3] w]hustXSsU38 ή(TrS,Ǯv@emOާˠ`{_YaqYT7¹x2)I E%]H ׻% /ʈϟ |`Kj<%x_t[*U?P/l?7jdA2T8 ΃:i[y~9 >&x۟Q7|]p2V18z2^HsEG bYxzum 2jz fK-Bi1bTmD3.)Ӆ%3؃߮ %]u2Y :{.%_@D/A>E&$ UE>DDgZ>/P EnͳP-=ژn~kh7E8.XGAhi̹ZaMUK񬹺ζw&ohPzZꬊ`cg9Kvl*8d; Pp(Plej9R͖XTŖ9XC"  N!%}\6|)AψˢIJGqeT2 eA.Jyl+d/Ouc-hZA`_ݑ51$Jh) &z⺮GUӜ4hkǞuOVL̑?RsGu- ҎN7/{x,rP;/ `!ʼn_0Pμr8-jgBC%q*SO s;+kP|k"$zo=&]R͕g> @DxrdԺ^^}ɶ}:`TG49iZvq_ۂq%D?6g=3pJWu/戴GjU|cR֝R \m1g/ 눪o[\Ƌ6o٘q*՞x{?x|LG<f[]]5[7e8^z4z)5k.BZYꮫw QLzڠ`n)ÿ ?2ee\"XDrf,n}CP0?SCaE!yaҕm[H)x](PS,gCv.gLOBo+]\vf;l2eDĢee {3Z0DS_KTa*ŎL~*g&U*n{߶8]ƜfNf"vҼ9\ !R 8,)CZ[ %2V CyZФf]s{7QSkX+kX[&hC,K{55jy. weT Z0+vˑ Ea^Sd'3w}5z5YF$I=dc(~Td)8Ĥ,c;2f,)xIsRc7>c=s{B.^6AGPOzaK81ӫlL*;VV8OO)tfԁ4lCˍ?u{/Jl9p>/)$b&ϾxPi;lv;@_l9+`I9:)()#>6+Bۋz 5D'^u}RHO{I007fW mЍ>*ևrf]Vh;M=h<* w{>"]yF>A ,K @%1IqEpæuRP+|g% if [K!aH{dݤH)>X FgT .TSo' 8Fť+}ïskN13^/\?XbmkAIPЇ._&ZņP$2f2$=. ] oU3 4ͺB͙3:Qd'o '1n|1 6e./(~6ov؎GZH}di6yE R>Tibӂ()s6r1ʲ3k Xpzm=CgO7{af(&yDB̏&IUPo^ vr&(M{ PjfOQKBTa#lƅ pO}EHr>IPI^7EKnmѲǢsvxĢKAl uN؍0 C9e(TUkvm WڻRg$O0#'fz| ![sZܵg+aQC*m;,Gٗ<PhU+~7{EWpT?C)?]春r[xo+tIUA  |G`^ DGݾD -azq{tkEU@U&inIxj8K~#ғc4ɫKkWVsiO@N~[ c:Qc%x&=@xl681(ܶvtC*НK[SS@ mIUUr1#*jYyyB=td!+A.il0:W62j7&A΋, S]N [q?JCwTa.: ~D6*&ʔ(vGm50 /aF'1”".i2,s-(;^rtP["-7=1oVC*5uhW/6Kf>>8I8[g,2HIb}(6B-½f&{"FF tWN3͇٤!缚ӗ Έ.ELqQV.UpRy0/6w@+|:]c$fIQM\WdiF!O@$;t␕Qg)E-; P`e=D_&O`m)ڤ^%Hl5 +YB @d -ud2`jl{8D%>, c䴣~\O_rbN{a)Z6E QhuIo@e?^kaKތ~wষ5rs1}Dp}ܵHVW'&kZ)9Z9(BF{Bw7۴sCC.{|1&d-Nž#T:yϼG'Aŀ}M s`2Tv! 0ʎ<wu+%5l:o>/HVފ[6 p9 z"3*ܞY3NX뀨hWT-?0ii;} ׯ;*{MhC$tUFeT)J߰e2b-2[efq6"icI&BZ&WGL PIοz,c4,80'&XETMZS7csA?˟M+ YY'5?LIH}WS(Smz*ouNF;/НCΓ0 YFęɜhyt !mO WG5,D6T;Ћ7߽-p:ECY'94U<ɶqd/_GQS}{& Yzs29+plP 8?;ڼ(qHн @B:ؚ/gł)]: Lq2^SЬ4ٗr]ٻ2A@Kl/b(JA) d'N-}:rz Ӂ;l%yeJٚޑ i6)aRa+u±"`}zd xU!hruTd|(V[}dh Ҭ@)8`8>Fsy4 cEh!s;oPTC`H0G%` @̝P}~ׁc &WX &zySGƧq\ʂ=&q=.kk4 <[D;cs<&N% mIP{q\'€DyLᦧ6WxJu,Z U4"[ŕSj4iiF1T-[ly"IIPGX[GA!^}[\VH򀵪r2j]a^-d ̧v92gA@+Y&Ȅ-%p?\`  = ]3M##ɨ4NQi,YXf㘘8i$ZaqP{4ݬd6$rcS=XFƉ8=KַVIJ˯i&_08h c3 KϭeĖ+/1 g_Ⓕ#urO^;2~ |d!=t-| &탷(<&;G#\h9:UԮ/FRj)K *4\_PqMQ C>r8Ե1?w9kTv#UDJuq4VG҂vUET2o-@Q̅1(vP}='Uq7}L* g;L-Ê8W.JY@n`{/``7C}ruG.0T7i5+7bǘfMF|wO*eH~rcҔnI0*wJR$ /M{iwإ/vGŖe'VL3uGL `6hoe R}t@gA(z@>+bzָԆQ{l}iw}XiHWAw3kLkԎ:V3ٷQf3%Ptg:CgTvRG6ms gC" xr SCF'щBlKYN5?V/p^%UJ ?!b~pl$tl+PAcHӬ~Zt>sEްeYC_hbg]2y`IUzvYꉔF+ۍERSCf_>j8T%sN&4/H튻2rbwV*|l~ߦ _uB0ʏQ5VHi7^RfE1|<,z2C vnD߽]Jxw0tPҿQH+Ҏi%awE’eetWҦ9+'P@køe[#iuaqSGI5BcnvoQo.^=j a fm+?fˍn$VAlG8f^``EkRҴWY $oy%\$ů+o'wXW2 A*X Ii4X!>3Nϫnc3iqf/A_g|<^~t@RsܙC@76`)Ǡ-)}~q&Ea=oL!⃈ q x%E}帹777?@#}Yk)Vqa9ڴyB]m\(pn0%܅lm*)K * ёz>&7QKnn|UH?n9==˅ gaf)EYnNbSl:w1E.PPѥ{RdM&Vd\.h-֡k_$,!qA*ق TH h9 m ~:B6rw*y'} vU^|\#v X./9j%Yg} ox3_g7VEhVUy`4C0m)KpS)~pCTЩ ?p(& ,t<ք.oT"Mp헶*G ]:Q^C:x]DՅYZ|>H%ώΖfU9f:sdxG'Aү@p.L_VKEᅚbPaLYxnIC/ ;Kegt}?vDo܍'ji*CuFeDġE ŒB֕M(j+0(h#}zD7j.QCÄ^jX$QazA#c||%$3ܖ`2.vxdʇߤ4l@?o ] ΋hX-^@ZB.: 9҈_gL[| VX=NE} Bv(VxwpҙF suԵʮshս X$gD6[ꐶ6/ڧu_ _Cn\M[{`rVc[tVHG{u[YgBpVW47>M:᥎i<6TcnFҙaVݲBv>Ԏҩ5:5>{ '”w܈$v>VΒ3׭!l.P#XV<*jy1Dn8mUӧÞ-;%ܟ |W멓<(p`.&S_f;2Ke3Ts=W GKpqGDqAŌ҉TGdưŊU^ݞWHhZbFSj[ȱ<읣ㄚԶ-SC,L3a58z!ۿ=FTq"EXKlv3CqGi_]Ԝcy<4pĒbYo{pALmЛҋȟXn۱S3 ]F2GD _HzDBߢcMc3$tG-c=]Y4+~%mEJ~^JUO '@tٺX?L $^M \9 $노mL)Of>n-7]ę=Rj9]ߖCɧxFc[ͤ ѹzEaPGPx#(d 괨 pʁU5OB VE%WG Ubz5oR4ۋ=tSlVD/FaDH#]wY;$nB 'Fe11ٶ>eU\*BGMd!G:r˓}̀+EdtcR'FMVAM=Ԍ{) RퟂJIZRTסׇ]6.}{/x8.*o߆Ҳ`d㎐vV^4)ȃ"1Ed=*8UZ7h aZfP= LB7x^˂咑jyjtoa`r%(C.7j˘.OuP`ǯ/J{MIG)(.&~ :ҧ%/Jy}}h0/|M`lF%=׻]ӄV՝(MR/ Tm%C^A!с*WHJ u+QĥKcRQ9 c6}S}ŕ}:R=(5]^ijUO1GW{">ߧN_eD7$lDbk>C.ԓV֌h ss*5|.@ͨ*4kٿcElÀQah]?(seM'2-t͖|d#C^C/hjNŻ` ˲5cyC) UK2x4;=+#1^JTL\V`A|*$e8Kmv!ǒwgK"VB 흲 *m#&UJ#mg2jU`AmH nd'H nkh掛*uc8O;1'Rec*4%g7Xa<l 0^FcjT 9^i[|fB>.jAY9ϢS33}"U>[VHD %b01;>3#{q xuSXK"49Bh+㨎]Ҁxu9mqgɫLeBPtm3}X'=R"] ZJ Qʎ aKQ~H FDF`k`VҍD8Sup=y}-OFM ͻ8I;}%k5t}v%Mm}ۤ' kh)iAݧ!gHx " {)/3Сԙo$APK~F 6P&lPAIXFOKxUACrF"՘L0[FWTŎ鴸!%*7x]%?\Q4֨m7wn\7 <{A P$kUޮVO&$[F2' ̚"@=ފ^I^&ۗ*4IORx2;#y]B.+Jv*nK}RnjNE?#53CyC=(ʳ3-}XE Ck%8GWVtʟC>AK!y!bA2a$'tF"fHxeڔCs`E0y'߉W8uhBel`{Ƣ#rG bʞHP) |Y7S}s r0z~/Cʓ~,w1ԯ eYEbN:lg2` D-r]A'q.s<f*yx OGm<}Kib4`O;SsTO[6. pԚU!`Ȭ;ɘ'gG@5 vtPyYH5/_u;lQZ#ҍܕܝ_ r/^ DUq=}i꥟3F!fGT\}Njհ6ddf1lrn*X͹;Y$4ז=N- wU."?P[rT7y~%,4~~!^Μͪ%^} vmQ4Pg֗]E k0X:T rp߄njU5gk*M_=ms@iS_,U~ߗٙRj2׉;ci"ujO4,3D  Ij+)2BhA#eluZ%)7țJzkL92\HH#՛1p\jZxcѼ-ϼ-]d^ CJ1{4+eP#@(aGp_6 #i{zK#!` MdjuD#3 riyhX&62.tpF&F~يj)w// 0{T^Ţn$&"#Jg8#kl#җ|ёFClF_IT!Y"ZpP3;m.ڝ*FE6Mr\(vhLA{߶'unN\sO(}r ɂ*97|nj⃁25; wXq&A!K ǻd> 7oyL'@14 yl0= ** !ÑW?"V<ѐDy1YGCxU"Yv W`qAe'ս؄2795$zS"@. xI>Ż@|^$v6VM^qmV]5Co!IW݇$b. =ňz$x5ѶM˷o}T!Ϥ$j!bR>&^hˤ'nW\P.:@PT@ZlvY37N_pRKEkH:WW?@噹 %>8WW6ߚf\{n``\/˽x*[6biz1$ ~l4\]=aJ42\W$l3WۮP]ul؄/X&@g<,f` $U 9xw#j'tܘ̑:nHwI9T\4,<}YNS1/e wE$QrkDԂ!E#m% Q_F/9}J@h7~4(2{ żin.-/3H"So@idsY~@`t%*fzZfe)tBu(&yxOr($}(۰lH"W}2)'&ÙѬ"Z(WL+yv6~MĦW6OjXV5hEt#WB[&ᄛx*niDŦ%W v 2,M:7YPGVߩȧ8aM\@E<%()!(cx_%[ytD^Y[z>Rf3̤.?K B=b(lQ:0QV-ڑHmD1=UԂBDffqR ctSU*ќȣ,+G>9 }lwY'O;Ym5XNh:R/[L%fb*uf$e9hbG %IK#+qr$0+vcw?8lL!]݉ch꽒˲qv8;⬥bT#5F!؂>N3MŰS2BH;I~?FG{j1t1+~cNYaSDW" A1m9ڹf$Z%Oy!YMXfn)!j7SQ7*-1oWwmadߜ?.w:ؒN['kuyXаs jFoex6Ԭ* i/y>H15hL*/+[7G;a\Ԛ3-.nf:cՓ d-eIc6NPI3C/8H@mpWߦMGGl6֊ps!d<-"l|,7'\tk_ߟe~ߠUܞ$^ ]+]OQW',M9W J EKZrF_N_s& cM/Ӹ% ҄=;a9}fѩYn/([C4(1&%$z]H9_d-=AD7Qe8 lJueh垮||Q?>%"Q g1 zWof~/Idtf3@ɮQ7he]n"?}{D믃Q(hJ)-F*D"}ƫEvUT4\v5i S-Y# )1D^14y^@bUQ6, RRCj_8Y߮9|֠~2M`ks !rvPu7ŒyOPyw,ߙhVNIFs B ·:A^]w1 ?e^KwWB*ީVcc!u0vᏮn9ވ;謵ZN7P5=6EMW~$4p/m/gT*yO2pUZ\[&,kS MD@c 5eTB:k iXeq5ՀVGW3U/fHM*XV|+l!M)0XZC wVl/Fj0Q1m N {E"8[BLy= V5 ]sqD8 ,XOe`ܝīً,gl^ vraFPo;>[ 3w:'0 o4ɚ,ΚSjMpz74Z`< V&->xD[n ǝ5o_|اbQGÉPT2~Π=xb+s9gtrIܹ:{cs4y{ei# @ xPwr&kBsZ9Px7.~ixgmfK/;KQsVpf@{$Hf*CE y2o.bnL-\SԿ3b{+=#rPos}XZe'q ;SF6#8 ~=:[Tsa]-^'7E4:-܅+SޓzmMY!ׅiʺGf1x&~- &dك RYA~a+U;|1<^%oc "oAh?7ϲRI2oD[ J]2ʻ%KF0o/ICݐްt 1o#xi%$&!Fu)fMZYϣ鏠aZ ^.z\[HXa kꖯP$woD~5٨,*Y)'\ 4ܸZ,n dammaCCV4@^]0Iخ^ZMQjf Ѹb 4<8hJRR֊Bw Wp-U[zK ΅0BEތ莈B:} gQ|eҹΖvd|M %{ s5tݠcH\!W32[+qHg-KGk26HhD'Y~*"#یQ}I”%j3Y-2a˫.Z<"pW[24"IF{c%g #ȅ"313@"`pW \%l [|ېPK=Sp[p /PR}lo¦hFnm pe$XÛ.eh%GSJ4<G73a0bO)nqKz:5Y**WH0je Էx!M7N+>ʲC$ BqSI]A/$00Ƌt+{~*oenl*+B>n?pf^n/*vwkTwҥ!I%Ȓ`$x_eq ,f.力inMtƤx3JSӬG@JbJqѹAAeeC`^9Kk2Hmu21Vk%oU¿Q ّߦ&ez;;վnHi$6)dFoU :KuB*7!Im<:ŨcijpȗX;DϗH0#H8.Wư|J GAPl*8quBO6Is|$]hܰyhqxBOtɕ19!G%%k(75CKA݂c!>s;K*_IN Cc[ki?'Tb[ߺǟy3O'9b?%  5=1oVsN`*-rwp#ѓٍzfMv YX Iɲ 7L Z/b=)Ԍ!GGtaI7cȏؔ@,xg2A( 2w:hZ >ZZv/i+Ne92O`A`+<&zXKC.!ANR;r_E" 3m IQFi2Mn9QZsWES?WUaVY c}fe_fm5Z~Gmb[lEjLEr˷mItW޴C ´/1*7d =L !i=N4  U$vݚ K&Ru `pxa:zbK̃@X85cXµr-v(SW<2AB3RM!l1r$ZclOt gCK+=L@#0YP[C1vmbp_`{;+P{k=_x{oV{b ߕB]GfRYSʒ7kȺB/Fij40HLZ"m8c-p<>v)ń)(D~¶Dך}H@%ЎW˲=_Š]=?֑#q{ o_Q׎ _w GKٿ S"q}v"sSPzdT!2,y"s(!I Pd_| 8n;BPCbWHv.V\m&)0G"(sS{4~s  msXoF`M5nKZzܙN~ 9݁j%x{8(~&u3a) Ң˂md8Z%b$OOםJfX(ɢE-9F,-]~$g=@BTaDb9Zy Hz-rn,lqݳ! (̾Ez ?BUxd,2P&TK% +pSOIkA^7uHY2%!xVKQ(x\+ SD{BlX᭕,S; x, M!20|J iJlUTdx ]Jt /DWX8Aw /w  QZ 5˅ cW0X0B2"]XMFq^#71zP)0a-{i0 ;S񮉅]{x|bk_2br+/^j g]?$l`\7+4+=SϾ c">wr 2M#l /꥗DGePt8^buɁ`tdT %D^. *%D&qp h0pUvJ"CV3N5CUÖEAVfAK#Ny1 c:nβeOQ]V?> ȼ(xoC^mW"ܦ}m⏥[#z]Y_ Ztu! 嵠i&fpz €GOG8o*$S,SL)YMM}(0_z;pnp~p֜uʨ%}w闠."O] E2]e͍aUM{feL7W;Hrw29dc4t>a3c#2;`Mg]45K'~Fz4npTViJT 5Vd8%C= qTdzBlvs3Ih_c\fݶv!l0);z♦G9g! =k45$gi8yڞ):pdֵ<2mP˕[~gjm5эW]ejg< ta*zN1xwzsceiLߡ[ f^@w:sM|tOib R(î/lVNFQKW7 ԋW%@&) 03t: E}`rNPѱ8@LgGۈIi(mX&Am.ܐ0uk~M?t"I)"80pd!+y3 zZ?S pj] @foT8Q4isNG(Ua~  ` 훮6)uk>ɱ'uϭ73 !WXǒ^a`p<@L۟BbED:p ~j Qw5Jݏpa"R|yZޗS"v1^Q=!SlAݒ^1rKܲmN~VKٍ!`7A yx 6݁or.d \*tP@'5beaomz%&`[t=BJpQk sWu:ɰ,`5^Ǘ[S[e܄klMm:KbhT@ ̄=9٧Ђ{6,TpZbA #@5C1CmC[me#&A~jv\XPBKrQ~$,_lC hvpP3Ű)phdWD Hnᚮ]UI6~%`bvi2xZm 8Ud{ gfҿꚙLh,(vNs"iXIŏ䘙5 @k̨ xob(VN.uN͕o=oFS d\>kص{@LKY%Wi~#O>w}j-REq?}KJQ,NJzO#f}A*=[Ӽ;GQ܇t7H3qzk1kOlrj F#Y7@f,;!F&br>"+8؋?w9?ڳ]B\3R :6$wSj#Fܻܽk>>i`n0+[xo?}"m=L?/S<Yt5 ۀT<߯A?~ܐcFo߮?zO q҂k/NpHM,LJKϗt7PYj GrXϱw 1w+V^=' WF3]gRǞn:їOQI~1+]q=ov6@mKU,`5L mԱSNTd1K*!WƋ-N`c%&/؊-*IQU=РMk"F.rkR[J]+x 1DWSyMtw$@YTy8DkU94^sF H3O^mObՕlT7IH^|z|@}9ʕ7SS?r2F{B&19f۰F.f[f5KWʳIȤ#va?U =\sjɲlQPF< RQAaCaWf- 2:ox]=>O 5?|  2> 2\Cw6CM閰\6/ iw_ME̜3:w!0&MK[hrϊ96Jq6z(nMSI "O6WrsrF#L|,߄P{j4_:Ǝs)3uUغ;\oDrˣbeRl6U W&& .W?6LZDX.$=N(` F 4s%NY S3h~ZMd-DۑK_,nTE\-)\Mm[˞S0/"!M*:F[YI:uTFIB2+^tyTXKjrrus@1'd}ޙ.7kxo΍.#B(v;n:˶T"8mщfE͞Vɽ &E_kJ#' £Y;J~fJO8˹IIF =ᇬ p"_7UF$]W"&ʩrܣi8H;o͉`J)&DԲؙktj/8JqUarNI\>֟+ڗjԊ%!8](k|]x ^9uuCx1xקFCn=%b[!2Z2#GH.ܔH-cgT8 AfyHe)мiZ*C{pIo}VwT+]R?k& `~)aRnZ0͂BVs.\ۤЊRv悴u~D<9=3rP{ ߧtg{PW֖ )L$l2x ҿut|Y#/lf ꤩ^exu=fY~ 4i +"%E7/pM>5m*U<ᏈzZvrUIK/ \5AΞU2\CU:w* дD\-zdJt~;zMSz =JxiS7\ATbE'9@)̜Qؽ{,U6=IJPsuSnl!!G X ZkBBeð4%> 7bwXJ/g=[%zW4Nˤ&v,3Eقl&Z mi63RYd"*,*W;tlV 1iJ)/&{=L0h#ƹL#59y NdLŸQHA3l'cޖB'Rd0#p@MWzls)$N!SVe@>S2\y1!# @;ڵ =2֏zUiO=qRI4## "nLAqqnݷoڋ6~7`+4 0#+ ٝQQS!V$UDl= mVHǡ 9VՂ.:ȯA0o7`EiiS]Tfrk/d!&xha5kQES|T~?CN[Dg3+44w[0 QSW8&'59r3xW@1F?Ωb4&g`w@-?X9ٴTDa~>#2X-v(퇃>?){0>< S/ر!Νbg%hYdk\jՕ,{DGnh=Йe"#ﲁ(ioXGsXcWU+-[:m^c^l\K W&~t1ǝ+Z`} ;hK-/uu<' 0|kgOD`d  dxHbf5wq#$Z>7Z]¦*'14Mz3MC5ZLNQUI!%"bdSşQН4odjXg>߹;3ei'xzF`BAf E԰ck$\qz/%F@`NE6V+%ͩNMfSj$>q}IY+AbVLE\|RW0 GVRt2>&LQ1A#cZF)wP ,l*L&MGuѺF#)1!Uȳ%(sl< EX {q"k7*IqΒo:&=Բ 1FS)?nr6Ʒ >p7;rEKG3'*phJ-ULlcwCTh~e٤`'YJI'k|m)K1,r7aS{!͝n3Ih$sW~ iez8KksmUmr3-cl`kqO?: cghuYk搳$.4-r- dr)4;tWLD^x u刳@Vt ۘf$]xդs(')DL=**aHu%!5ы {#Df v)lDy},| W ԓdW`XJI/~JHMG$4^=Uzj` A9ӧ;^b)) S&zBg`87넍U~ ?wceυчa|2ُ,O =Rc=ma$GRkl5e\J`O.@| ܿS eb8QX*yݠS;!JdAՅNCw\E,Q$gÀ`}5>OgVC;45@ݷħ&d=((*繊q;agid]0Y "tb5Zc a93( j A/WVf_o ͟1{^|bA+dwX3e|M}/%9N#T)C/Go;on`6f8%\_HK /0Âvx]jZvf DM!%p~ OWMk ~-EVi(7FRo_N8ŝ |~~ή<_u/#H{3d^%"ֿwƘY\1U|+%1`ZU.ZlI#/Xg!m$B4]9OuAIt\(-WH. l +fws3fiM:loFDbN=*>'ϾR) +OE 5):o+aZG8 e+·e+?ij cgL ½ڏVBJ8`+"b5/[(ϫÜus'YYTnoŚ1?1@f1h 0foESl>&$Tۯ¾ Fիg^BXiw*O"IJBU)& tΑ׍Zt]4Vڦ!Pu\u7={03m73$ IǣDF_OO`6!&D?rW6%H-ˉqX+߄!c](|?L~+^PN N N.-~r YVKqєI߁:%+]Ҫ^Dͨgq1Q[ d%HՔ-hчG?l;Ϳ*u{g^]Cvf& * eyb0$B "Rif3t,i-߭47Gw p}7CˈƑ$`s g8Q;} eP#* HѶI-n?7|Qz [AyOF"Ɛ:csvߗdd;_>H} 1Gl=lS-$T?]+4Ɨi AYMmlwcx#3J|C  fXlsNuTmw7T 8,$V-5Y׮#'Zwd䔙71gCj"^KNVFֳc .6^6iA6r*#@Vp| A=\! 9=(S_Ž[fFZ UyMT^w;Y=jM96gSE5 };hgtWՒ#=<=iwI }t 9ݦQU ,*^qܙ(b,6s]nj_8{\HUZ[Ń9b~XE==Y=yR};:c:<X,ʚE62C,H)]8$O J?H#zbD!h$u3?Ҿݍdvmn + =Z*ߚAN}!Y%Ir+rYcAt92>v)oڬjK\TV5|oBq2;(ҫqߒl}an(ru+J֧%Xwii{@XcS1*hT"a'[>@YJH^2rjr<K0reܾ<S|`4n?b }wƨY*(MQ(4[aM/vM [wi{QGT5֊U;ʖ5WhԔö<:@pjٗ1= >;⒏ ~+|/˂)!I!&kȔt!,} n9Sg)mPP8@ 2/jM"6coJXP<|7En@"k߱3ebʥkvtXh-E=B)$Yxd*< t~zr+3o}֣xp(SQ?r\訧+N0WssR> AѬa 1o\WmeiPXB#c<+Nh0W~N-|ҭ4+ЊܮP zkYH ^'i}u Awmr29 l@`AP UV`=$ws1_ռhiByZrxғ"'b; EK79!P% e$.3{{|x(ϩhN NLvﶵtṰN%`kdDV6}iJr1'z7Ǽ=##|MBҠ>z(NzBzurvh37"[P(`޼Ne, ]SBf0juGF}kؓغnSJÉԑZο2d\ 914 %̀~e+@R=*H pdUՁC;a՟LǹS6M CRHR8Z8T0`V 1lBpo$ z0ڀK#=j꡼N=g;O"Oׯr>cLua.k΄Oʁ!]_]'+ha H5Ny_z ЬV8wrKan﬑IOmɺ V; -̗6bi-P9N>4߮""=zlK=XSh 0H÷M(wu]x}TEU' dI]2sIu#2iGi!iuuD= )G|s e=ȨK}+LBLO/6rMJ guI5o ,kPBmE<Eu-v5YS\g[n.,gBl9h2ȮvݗO%,D:uNuJ 8]+9.6qlTȼz/ncިZ !H_= Z[sl B52Q4x,PʟQf #͟ dfeJF',~ n+48 OfvTW$c/1S B@u* ? ہEqBY|s7g'}@pQ_pz2=i /Y>.l .9[g&n򲪢:-x]!M4852*]n8yc_ | jkQʢ15fg(.4T"R5_꓄:= qb\k3RnoZTZ(l a8#%ơC̔HϏ>"h\Ku^^5a)IAWMqf(G-QYq!&Tm'AJ*3jkQ}}-P<#oH[GA޹I/+s DǾoT>ߜ+ KQ%yr-ZKKdjs;*6Wka*.d@[ ]Bto3 xת>ĆXɿS|6 akMQ!up(ʭ!|0R$DC <)B9y1ʃ6ty.4 j>x E:5.+#Ͼap=~1'y`dH&x`˓e`3V6?)#:z z&Ms!tvIK/P*Ws?}˴ܬ`\~!q)cPH\?QUԎA~b+YF[󕂚bFsGه/Bf}W ydN?k=vGpR5Jrs[̈́) R#J[lj 5<8KZ.+ʓݏui: Oe" txs~,Ej5 !jkߠ|CQ0ƺ ^ Ϡ+8[왏&"Jc 1(t Iڏ\=ȑOk&9&΂ѱ*if6WN]4hSKdA}ݎ+sj4!2`߷OO× ^)}nbI')&{]<6ը] GAsH'̡UYQ[Xx7Wi՛}L3̖WT>Y8(,w{2ل92'^w݌1- } 땖0z?ǡc5Ur23γxNO!uI0UսRwƨL|21YgO15HVf-k>ɘyξ!9'PeSVztT!:~Q}w8sJL*+Ouwz̔[꩚?mIWw raXױVhS kNqK?697 Ā}cȣ#GnNSY+GNjdyVj]j_+P;u`FqXY ZrL~N qA W.aZ&7XpUxe vNNR1ZZtHQp.>)1/t ExE'=2{@/V^QUp?89ӏy-Y23vͻ̳ {bfS,wN*)$"]]>i{2ȇ(T-`mml mS d=r9ZSjo"$F̺~8 (rG@eebk 7R˭h>"M+<^(Z)^-җ Ւ܇XC"3JX7%WAcU9Z-1A\ǡ-@07W \X=>0ң%9Xb]nVGM4oT 4wsNctV=䔆y<\c0(* *Ι.q'5}Zap`.;~*d>}4H%d:-ɩЎG,y\1tcjl5 /*P,&a}i\̃,+֊Yƪt%l9W&d(XJɰv./ػ@>LD)fddCKz-v4q]5PC#G }x @¡I48r&2_9I5tMG~ydn+P.5ƑbI-=r:.  ﮕbmXқn(d:[` !=5 eQ yV!Rfꈞ5ps?SLN463ן,\Âs>a"ABotLQjlI.Ö쫄k?,p}6g@d9%5esB->j'kRMh~tCƶ BTf&y*K䴜x&j ݳ^Ȏ%FJK`oI ű۾n* XF_1QD>BA'ԙ7^g'*VM{q]3zŮ3YpgSf @l .Q]Grm<_zXj#lLG,:?4Pq0,4-xA&Vt1'?AƗ׻DT\"-ŸukDCh nT02uYMV z _kS&OrhAJKnXs([~f>~qsH|*EFbpyL?*!]G@TW!_շ=ڸYSzOW˭->]? \EΛ-ihRiulxVKa*{pl9yE]T*L#`%`UC>ДlGy|4VQ׳|A!-:G߉qT"|VI{R%M`Vw;V|\Qv^?L F픮HzRCC]灕B|}H꪿ݘN :^VU_FK4&mFtj-<>Qz6l3~yP6ehP>elVBOUCEMY(DÓ{ g0G0P۠boذ AyuUqPM^ )2 A)է2N)uv٠O(mK/RhPมY,Ns?lj]iגx#ۥbۺ1ڭMi2XSi:<(R5XCPV B7p, 5 ɨ306]i98t^m p}b 0߻aho :9n"K;`6z 2>Q,q P؇R{6Gh)H\2X;XVRo+-^MHq9_P'<yR7M13~i#0فc^hn8.ss N3n)4 )]]Pw@2޹ \؀YԗԼk#o{ddbqh86ȣ$5+۫s Q0}n~_/w<}b.LH',AUf6޳|#/ewncC|&۟)MXj_aHam^ -tz.g1Źu㹐P6Fu1*xWH7׆ 0riɚol3V@‡XoacHߍ;Zq!ǿS. *g,µ-5y.4Y$S+mlކR&ڇꪋm:A!owOSH*8z#m 6O8ڪte_uj82oitv&i)vK=6[N+MRO֑#PLkXPnTHc#) Գ1zO#xǐly" Vt䝘w Ebá9?Zqppo<r7nRj O46ۉIE> M)f "bߣuR*~`@bK>A(B -~E<ƥH3fx\AZǦ@`4lJܺQ znBNY[\ɕX2¹ACuJsWe"t8h+v5cاT1L+”6>W-R !k,u8 C(: '::VD+| K26&\"@c">-e ?y~|JCJ!eE{92PPi.2'7+ M(!`ؖ)4^၀/@K"S *4|mtg‚+*pK9Y c|co맜KxYԺ5bNS1LFKjF,xrLXFLE|QT9'ϣ@S( 2-m^&Ȗ2'9EY"[ ۄw\NL k/HH¸9;c (%,>@'|XZ! оZt"c>ŸgLK$K7dudƽڽ#<¼ekfqB&mi1R Nw^XݽZ`dGL}j)Q'8~1d 03Z~ RYǃ5$K3!raBEys?}Gұ79EixS4"n8hvl'T`-v8ͨw^&pٵd]ٟne9^0x^E{#uaa?(v|sHl: 435b'm >}@ު $s%Uۤ3ל&sie2VXw!'8zU{h+B:k&LvMȨ|d=4J^ٸRKW[\OMQU Iv(NcSݛtWuɾh2GVFG-} VdP:վV=4lxSGX 0vROj^vw<ݵьN Υti7@efWW_peȺu9\GJyLR5fnOlGGēC')Vq?1l,"fQsk0Bq|.>kq ﯜxA#+pz m~8"4M*Pۡ)t=0cŴAo=w{RGcY{e@k1=܁אO `گ&;[3qsJ&V\A괶m9yiYz|s92*M3(,B=AIꩰ=ˆ ;j<)lN !IUo^-;PPDeaQj0/<"_Ym]:=|ɯbpx+nQ7XѦ\C90%& anM` n`[Lڭm_HiQ].%|l_q9|TxE Ȫ$8c,oۃ 3VnZGHkFNXiA5{4MI^]a57vҥcRҍHjosc"6?KCmP]pPD!€ٳad&xB9ű}\/bܓ4}~|Ff ~@eH|L.x16Le{w u"7G%U"`+:Mł6 8i?sn𢈰7{HR$3KXeNyK:% mϹoQDs;3kP3]d8_l9ZZx↷O(tljLvyފߡwP3Ę \~9Bu3)\ӒRlhޘڵ%݄6fklG weV[4NjÎLrHYBԚMYc^M QG%52 j$8#9ˊ_P!n~yd"UZYyj!T$J}W[}U[-~êrwjF W\n`oZ۬YI(3;9⚊$ɺyLr=|"KCL DS$|?ǝ:kùJ&,ۀsHVZR*b9mEQjEB!褙2-& ٦[ kZ,0Fj[r-n$Jr$q!Qlc>ΜD6R^-wє4"˛tB_7//I57x}\r |27*):fmQ'gQ E/|W~# +dm`Xb첝{>WgR<(3}J S/1Y~MJ[&?I^7ߥa#,$qE(wQ192ɞ5L! |( -pHu7+ |_ q 9X%?- }ڒ`K; rA:M{J hmCKucׄ_$"X|?psgF vw;,0f!gkSg*˴@9B<+&#̘{-0Ëֆ_IqrefaHGm1F&KUC1$wo/Z0=r+9ɲRw<1=YƔjY] {*4;ui 6huB\92tœIPڨd$ 1-tI{/(6p]08CrxvpW ,YltZ_{!s#~\ӀNPo;KU͹`uo,%)^C` G7OwIXJ@umNEz$|6!0[P\ YG@Ǎh{ӱab(2Ӂ(^ 4rz^8t Qarrky;ts. Vg>TDE1% fiAet3׋PZ6A+EK$EF͝-X3.oq|@? #Ysa@wTN)~/鉍S@um7xzW۽<.-=ϵI4ڶ?jxX"t‹y Z2PhLNϧCUwUdHO:oN/?[諶A-BU楄_FqBRְM6JEq_4(wrk@|1?@~W-\᥎Inmmx HxӍ_wdմN\ .Ca! se)zOjvQwGm $+ =;a5E");T::ё$qj uB~RmIZΟ_3okh i^ mr3;Ob tb7GP!BTW+IVaC=^Cz.Vд"~L",'IxY7*}rF@JjI.6MjB&7v]o t,#J3s{MT6c{93wL+%k F9MuF: 6"AY$3MOwD"CT/=!ODG]bGnǟRH䧚#Wd8/ h|ce{V~ hS,DJ";h v' >P-?NDDek'9:1Z,RlFYMUEm##ӆbٖƪ~i()aJi&y}KJq:)12xNQEkCL4PsixS0=gZOz`N5${ ]=a}<>^eS{,}IV6X %r|\l:.B]|5r:as"M׾o]BmwȌ`@TsXMeueQu+ۆ{o`"a' i_"b '`o ɒ$0,)VshSbG+gavN ?kY (6 M-P CKf. _r^*L_i@=h+BK/}%F^k‚9b;| Sd֔7bVF jsJ&ķW>Buaģ37}lnkXc@{Yp%,9CDikukupr97sɪV*v8z'[d0g*'Nߘ-|G>.\m΀THB$AtNH6 0aSe*'OȏB0 W W6 >j_( sc#HD5EPܳeb8KʀONǮоW&B;BŹU·'}? +$c5􆷦^熗{Rw\4|b?MCTQ=.]klcc<7J9̜²)4fƙ ?W#bcV;@kn+ǼЧb'WWdh\; "@/Cf@GO܇jۧѳ7 T({ika"] ,4F x{Kqm%z=nrERV~ep mêMKcq"vyQQżi&&[2L jǙZ.Y3kJ:i"'`Y5Szd[)G~>(Ir?asz4-j_m?YU-([b%P+j2ENz9{~yw@Q{~vIb 9{"y.fY_bZ*_'WIljdx UL$ 1O!`9{_ (ώc1'1A_qM ۀ$ TEh!=aǕyL^|PUcwSs^*(+V$֪ΚqM.F. VW3nĀQFDK+ `Bc| dyR3_(/oPFoɘ$Zax~i8n?O 7 YCR[o/ߖ;o#'AvX7ox\d^i=5zq1کwy.߹*='}PY/1YcRݴ Kߙᔧ Toɺ=׻xLeĞV56̒Xc!\SO.9j$f%\`U:wga|TÒ:Vٳ\'%ɓŷ+ <†GV3:)X|F):ȣăfC~7"qc%DNuFw'O-SuW"M+Ublpv&]u}G7~0 Ib}'ZÓX;K2Ea񃼒ݝCPz j W4tѲ}5q]m2wVI(3S xƣ980uršyMqjŻjCPt>"Oꦘ8&i'eBX>zNr Afxg AV&|E)G"xBT&ARޡ *FsҴ2N۾$u 2σߜj!Ch.z Wha)RQSx[ I:VmgW F$.P,S:_+;r{$@6V]|1׋Khd"\ONT*Fwʀ1^3qLB'xBPr9~ΒB'܉aXT& VՈsvr-N>{IQNs~NxW'*cȔk]ؓK^/.߷(nYYg^ ʕuYDlBZ"TKd781gduhA/!F1P +K+zɎ GP_ԂqAz`"^ơ @F;e:@Cgkչy TkX}|'}=fާܞ=P`[hXpo692&A|WѮp R.D|g0>>G]+tWr%ύLJ.s֞aȤ_BntK,W6%KJ_Ds(1/kmNYJݖoPaCÆ^kNz AKF5Yy`Jf8£[ZVH]6Zm^JiU -mF $!ڱu[Q]ի*}GhZTG.+KafAI\A0%c,ɂvUEDm) *)çk6އ)ǣ!T3щ2ʹ leL7W` hxa|&D\y3Ö/W+*9'P?"ex zل7Ynbi Z@_pi<7]8OjPPi[r C34ױc Yޞ1ߣl ?4,XlvXCÝ fB-rl{hջ֡С=5@ Sgzc V~:A|3plً܃)M xrju;nΑ"R/4#Sk\1p0ln(}CF9vᵚ?pFu䟳+ߒ?>aLȊTwM H9/~:X{А~i4 Lde"CJdz cd/VRyqZ5-#-3W8kvr$_=]a oPvYy%ǢIC2gîjeM3h]$ d_#9n],د ;k@i\9!}ҩ:x*` dHTmJ)H?)"@ KDr9Q~jSÖ,\--CNjno"MTf釜jW0mճ*yuқ<7M G0$##&!-Z 13J0EtjxKi QnR!INd ΌF;[NwI5vȣ韓%:fn44}d/A oqmzb})y0 P_R?ڏ{Ud˩~SҺp+NMڅ.hͺ$21u T4Jݼmx@27k !{Y9?KKF;+Z燅 %rI (-rcĈuCYW Xyyr1"Rz2 j=MXQ#w,>U+[II D9՘kw&u>^Qe! 6ʒ~v|CRpӭsqQ[ipż$] +{`A%=wy%Wtq -G.}=v^%;Phw3)F8W6)RbKn.|_ÃZ Żsr?E"H7 j[?,z:gk~] xI-஧khZ\<2j@GQNʰm^k"E@4'Yvt`)w"Geoq([jzא,bXwbvsX@=rRU'@F}٧B?ElRENjٷ$ Nŀxǭ Y_y{8&VDKвy"oT]^Y7[ܣF~"V[ UÝi+[/"EbкVf܋E#{8S{9IԘ%hNN|~R5t-H4jZ_Bs=Z&3bE-ŌmkDT*<Y=J5~&dq0t(੎{ z"5Bqpm2[ɚ2㐨zZ# D4NC2(n!+?_/•H4hO+ne t4oE|QBO K1{JAGL8z Y)C?e1^9Py(ȬKp FK\'1E_MLX<MB 2_F8D]՝xYHߘ5ǖu5Il'.̽i7!хx0!Yr-X̖ H+wf̾8^T;@R?RM) 7quPR(4î |ɟl`2+tvB@ C,&7 5WFآW{HgxobL6wJyFPCVGU=Sf%\Q%Z1?͹1VOKB(ۆŽi$Hzf:i|B>^#BkU,/}6~V^CAutoщY˼. '@ႈ"YuJޮURއ׼S58AuFz>Qܭ %VY=bs\.{__6?Jrʋl<VB :9}u4]P4U-mK"kK\wQ>\Z>n"Śz7wbs(m-3g"6v9$8&,,9?i=]݇Σ `nKR[WZ], v"-jxjuYQzHZ.-_]S+`+/ f dҸ;jGLbn}oY)wadXb#^Fˎu ||sc!f2d7 2+qSB43_(aʱD@Xn@X3TH?. y kϪۙŎSg6JK "*Ѡ-pi2#ʗfmN~[+ s2J3+Up_2ϧG6B˒L|7`s9@.Xi7JwbozøK߹)ǎmK$iđOՒ'Aix9K3N ?VD :ơGb߷<+m0Zbj2\!P˂6IGa˲-..f\qXqq>gz UO/4eBA%EϽzYs.QFs/D.73vo4n;j4A!%Dn>id6Q=**)=D5[6`o޶Eotz{S8uy@%_8J#ނ'{2:alU:WlA:n|Ub*k&BStIEqK4BMgNNV-O i}3$%e,AqtUE#-KvzqHJ6anسTոČ0jaV2~ FUa⑘X>y[VTZb0&kH Tm /xɪSEp\6w' 0숝{/GƪzĢYjоhĤGuf"/ ywP0'"qߍO0n~qW>_%х @ʕ.t_^4@芏a%Vd˝t@Vr}/z ]^`c z;o['fE[eYQAq-om ĬZ/N_^Zphi0;P&Eׂa_(8 3RB=q2*J;fZ]-Htcju,mvbRó7sHg8FTMPl!%e?Bul%Š`$oj(J@PXH&jCQ+ʲ/mzVR!z4+5L֧*p::,-Ds(ۉKp_\e]F<WzwdkZ8W#ϿOw<;fϻ%]w+[eGtXؙdʲ_O y2 @D8kH+P Êa]z&o]g- s#jڂSɅSg%f@TL=&4jÓ4pԛ%3ۑϪֲuL72i WEV$ŧYS8 T,J^~#f!+W儀-?YG),ƚC!;^#\bXk b2CVCԱym$&MF%%w-ĬoƗUd7&2U/{˺?B*]Dsgxaߍ*L>ݰHz)I&@f@ܮtg&CȾcQ`K+qr>Km}U4NO=ktp[4ҳ<3kOQw0cCgqcsbz1hlǎ ƴ5{0$S=1Y>>8+X0W;A2ȭZazX ^s@-5FŹkc0 IpSьNل9ŪPf[srrwKo$b_&"%Ѱ)ɖf6P e͕cCv aEr1@U2iiP4\&f?G%X26ȁvsgneۺ8k(2#bn}lzuPM*P2сC#k1 Vdl[N6ˢm|ąw&"4 f5g:Y F0:ڗN<`_13Gv֔a8*8C4 W/POaH'ZOj^ ESwzϚQyX}&UuLS( ~ DAew=PX͗ʽu@y8Ǵr· `V>Y "~]+ '<ո!~R,nRZ JA.0W5BRCC f7aX.C]mZ`Yy_pfm9޻BEVK/"%U+)HۇֹcSU{m_L|[w[:~)ன";;6#(Is2t*ߐШi k "$T4P\ŪeNWr¢0h=tߨ= RƑ~4Xǵ9zǞ{yIa2aY'Xe5`xM>nT=uK C\/AfҠh:f݃d~ܻ }ɋk5^R: HEu/`SxSqr6:ŭDe_ znAzV=Z+Cnl}C _-PuFMXd f/xp9fܶ:Ɵ<`` 7]*h#5ZߓVP -ҎɅ[ٕ\쩲r(Bg }e v|2@6ʉf׃V!Ѵ Erf_k(\s7K=~ʥ|`,~}ߧ4g_rBL9vt.;?#i_utU#C"5QlO~cBCqy.<\C&`ߌG.c5RgWZJ?hi. vTHuIc"Gbiq.UiL0eRU y2׵=E B2t0.Jߜz>#2ҐLxal[_TCi`9m]j݅2ٿj䬻v%ds쭥0{ΟZN2{xrwa [E^so< |nT`Y:mi2_ m'~ OׄAl1 lPjGPipYfm@T'g-^ы R5"EQWm!6 Gi+ |9S$25_)%` E?UxՁB9gsSFgTwϐ)혀kB,m`o7KUv5 (hn~'&;ˆlko1ԯ`n-GL̇ɝ\`yfD'Ôb)8j6Zk``Z gJ95|fn7Zp:۝8Ԝݲm'`a뾞ծx*9X]êqae p"Ң}dAV.l£e׵7k&E|x8ԝe@ L.|; ~~EzJ糙{R*j倨P%@9d"9utN:jҗDJ|"N3[ZN\?1Qa;w[ BJK`s"aDX@[u K̑#V vU¢.UD&ޫyJ#8VD ǚ"?с_[- extb "Cc:V'dm.>Zn+ &YȚt`:Gz5OqZ0yBެ]r GCŁP#q9 $Nq%sӛQiD_2Jٺ@xA={5|$2ikM=J"6\mcR SɣɟD$r_s(YYd=K?vO5 RXQ, >`1}jXvmpISf[1S8ZG bzkITCcpbZdtkkXz~/>J;)gNbqD3coq*ԃv\M矙PH "bו9QQ\VpVg(ψVxo &.A V#vrݒ}:ߔ>?PQw+؄(i2ئ[[i6OZÂ{GzϮr7ۭ;P6#1]]iW-> ;AYdzɋwY R1ksFo!SHs;iHN,lPZg8al xT_9o+3BW~@Pjq׫S0 d\ֿG't~PDoz3{sÙ" Hޛ˜jsv>jX"lV m2*``u+Qb=DW{0h?H]n ?PEau|~$0m'v)5Q)7VDͣVkzao[2<=Uci SLET2,kp_viaSb.fofDBz4jH[{m<,2yS3]^ օhcD}]iQ `)8*&b7op? ) zTeBd 'hdNӐU!;$.rx"Mwenn(xf3A R@<ǼKqO '@zfxeߖxݒh6V<ݪ"t̍62wcd^ rR{O÷O"Y /L`L"N`S?D'Y]k؊.e!bw;{p"RWqbۜcc(nU2s'6AEkSLyI|W74a."&?eKŮBx}[ƜL[Ấ, CFE?Z2l8{ikT`wpo{z1> yq9!7dGVW1KMV-\9(goܛSDhW3p[?/)2fscFd)hl Le\e#qʓ䕌r.FJ̯Z%n-(״L|TAY@qFdcAښ2b91@A#&d@+}3rwV;`+Clп"@3zB7:ۦl{گ^m9ʩϿ*zidNttK0rfpMũ|{Cː'o٨=~Cf,CR0_jEM-skTqm5,r% NJ/p$~]-=Ozy$?QxZx1mXFmgRك$ܭsƸ0+&^ @6-XrO|~"}H:4Ô;kc,*@&ɱZ{32] \ sbdf(PoL_P eeq(;?te O$;2<+`ӱ8 Yu,pB Xᡈ6NV35nDpR_y#_/mh<q;b aY: kuE oD=|D`?^K9=CW|D>xd+uS\6R\PoŒisGp>[Фot=yΡ-r@DOQ]O5.lsN%NЦZV8&'?==H}EXÊȗ$0iy3U忶b"EF )S 8ޚ~ ]; 6u_jHOb.=fJBlCӝblR[?L5p꺩پˀҷdC=rn$D{ƕVC.'JyȼBLKS>dyA#nSس&"dBPXUJw #+cװXc,8+B,Z텠7gY0rVTB oC5Iu%ʶS͐'T؏yi (g鴽cIWaz1z|R#5Ai!{G$;5ؠLЋ iȢEI@`xN.(ԨM j`^$eū8nnqLF&\ A݉He<(NG`u]*bD/;7PEQO;M2[纎_6&.}XaJ5 >$$ݥsOP=h uX*yֈ\Ym|qVS8bRAI%FG#xbR6'> .n/.)X~ K3(NJՔnwk1kf,UPSɣDocߗ8&Sg:,GfLjȪU74rCCei{E#qNoTB#Uf9%fN`}DpέJ-IFTYaQk!蓁M̛ʤhF7'(c-IU$rh| PR,4Cs,"W⭶E}`TP`-ٻQ3[Ml8-iz#YjGj7%_bM-sek8Uj:~|Rli. 9uQf(nV= j;j@t^|;e`egT{ELEC2^}ۚ9'vtIrT{eB|qR#z^D=_ ,"~;<(s-4b6HN;RMj ;EdH+^MAD*bn 3z2ۊ)R85 0k\HOj-J(B@i bDTs(ϖ:Qܙk[vߵ|O[zlӖ>Z<2KB 9'=-G-Sj1tfN՛⁸ đR1V4 tu9'EӍV\]aFyT9j Aֆ+Y=-p 'u- *̅?ܨ ]x+Ng#&A ~X^"G0UŚQE &Ig?Wߠ .j"xXT¾9T_XO^gTc(NS DMr@U!H|Z+ۋ"XV}s_g| 4sfv>;X ˛`1ث~>[ xb֞VRw 5ؔ ĸJ$g [ bf'C d+ wG9SweMB0/>dd: WN~,07=?zk?[]My^&vR*i@wcAK&%=ecT7[?m\j:S[ xai80k w1ܢb6mJ_m* J1) B{VA<4 l]KbCecK r%}_Sn|ɩ\[c;A KÃc)r^7*p7j<  *U{<ZR7l-IQR-~yYE.94:jmoPC^:WqypNqS֙,}kPZyo($X%kIq%\kJc$ "Q[_ @(#-;Fg=6ϴnq;^O;K;0-Wf^7Υ^P2Y& 9I%Q7O}B;?֨"ў_x2eP`P~?OIcVծ MdwY{\:f9y(o!Mr ȑ9'2-? ?:n"jQ3saErX^r\2PKma^!'yW\<Υnq?GL?_H" vm˩SE?._(Jѩ BT\X̴`ZD܏*7͜^<`Ř-MR3fp KWX!m-H@ qt UO6Ol],(k@5'OGFd r=g{O p]J|Wo+(>/"0WtuF 1hxy 'wA7֡nfD@PQ<8.-\8=z3׆@EgǚɶR&D*]U-+vk~[CTq'k '?+K,GKjbXA &L9x)>=Ҿ>$ RДwN=4iTۢ~]iȮ+ٍ1/FBLHTk}u?uGnQ zrBPh d TG }0Ru Tq69-ņL?6%q %zi 3o3#.?(?*IN~N(h#Q\WHb![$j+{ۼ$Xrj@}`<CqUŬ İрy998 #<}`cǜyajEN#xDtiewkD\ f85rhH@p~%)\TE(kTw~?051qni͆6(ܞ>77fޗ#q_"#W[%H ohA1PQVB]-2 y݋P7~z|G5KA/-;#CHR٭Qs]RdYYa¸s KEgLc.ieIB$QP j% ^w(~.^Qˍa7'U-'ąm5K*kyQ!P n 'KޮA5A":>UVYWJ۟C/wjX&iǣ,Dթ8c=)TG6x䀤 =1J ;{f;=n'Y-AׁrEmk[g#W$0Ɣ ׹)YTTmʝSlfNT4i-ˤփ yK2=iKط}"NTSCˇ2v̇st1vF@XRi՘J~N:c} @H.X-!O d+4Ra~7r.18 *;P$oχK|}ԇּd0H<a2LFjyZqqQ<9߅:p!~$K&"@S[^R}]2ON降Zw%1,cpOa=K͉\D8GZS+D,Ϛ2m1uEy1&#ZV,K3Xa+' TG|Gip:@x8)0dqRkHo]`Xqԟ4[Cz=o@RCQ1e'j{ֳ/#o{8ltQ`a%|$'ע]Ӳ:< <ܜoώehW탩A =p/d)?:s,_$i?F.?W5smVEJd 1*Bٮ-R;^Jp[%`;;6K^⁦ fy;dna1/[qf 9 6ryL.baXGN+KnC{0 !O$] #86"k1# ۡc?ߴ(7: 1TG5d:"6=[H$onn7uG#ng!%B4B9ϱOfĵ@/ތ6Js)gT- qk&} sY.-u:XZAC~%OMR Wm9c0Өibq> _Yfj)4Ys9T@%5HFX9.Vl3T=z7U/%Ckע<mNo S'8t8%BlD]L؛sqh3 }MĂZNF^˖PvMZrSt-ϥ-n==wI.!֒t&vsZ Vl@,d-X 'xD$ M՘ǖ% ZL<ylP. +MR%됗e~& V 5ORKx| Fqz eA$-rLt>25bg@:X)8LM+e#mrQ9GG@]_ qX0E(A͈BEٗ^i\>M#$`Vex%{zٛx~fɐA[pATz t#8E|x)PcX9h8.3 &0dz-vysNLwk"o@Tw+$kj5R rʯVhE ar g]]f#L?AVl`_+260l4- Le,fwP&i'>6%o7se)&\2.)!j `mHt_Æ8ff _5=njy吤V=HNSN p1"!!{Ϛ+Y59o.(*#{H'Q{B:H-n?Ň~ֈ035FgZo!{2bd#CH/Eg]`Tv=TX+@7}\@OjuR.QLji̻gžs T@@֊7 Cr/WhI.圆 Ljp}h82ڶhh\#U|mZ^DdVq>i 71pzNCS g/5ͧ\lZ(|i w6;-cͽ)ٝɤG'|@b.D b}iuűU٬q8A}bf,*8ݜbS%azbV^\|%$DߥnvQ ۡ;+C_´>R 6ZER:r3c6p|Պ׼sZL &grgctQ'oa_8dR/bD^ʨx_a >omlF@zƟ? }?B"erbIh6kMZ#_Y'xEͻ>Cw8Ld!_*FV\d\D9|?cvG?Ա ᛭F/X߃Ґ,5KK-hTmwIgX%Ęs)$ b9c/jj"5l)2X@doL'y;wL},ljAz$]2~YJqw!g0[ +d|\gf_N՜B㛈6q)6S`5` V^Kg@CՎ>/hZ}9z .X0;ʫ0Ӕ5[V1ɂ0 iB#UeNd`u*A%M)DH@uA(~$Iȭ7.jQe"Qn4hcklt_]]Xyfmt0>^:~.ק~/I֐{B?V]oR6(BZ'T u%ťƚwjM8$/co+8MQk2C̶k:ٷFPP)G9 vԬF0 -Ih@.)Tc=".zr~ci(n`iDc"$l IXp!ɱA&4x"\T5a|6 (uaNOw6i8Zݝ;E4x`QO%{j\|#h%X#s}[JB4]^2pvu{q~@IPpݩ(ӄzciHAeVHpKD}֚{|-#~4 Ș8f"V\lpRqf0ҋ@ѽp$׆RG -;}y&gw]t;0w3[L46nӹJl{4@scU\Q/@Q-PJ@^h0+>PtƖT_? KA~|gkP^!Yͮ eebK}/ t7+5\g k#EלNyH ;eQzqEgssc! )\C#x)V¦=Q򉘵JAl8Uc#֓p1#8ooQfc/%H?#Y!N|rڏ/<ϰgᵁd Tbƶ(ѸH:5$C<TMLRtw\:θ#}N> aT2NDR6"Ӡo^WLⷄOݺ&{$]fp=T&>6n-'6Ͻ~li^nu-n{VŇ|z{TK3$"qdF _ܙKmi>SHvO۪(i(J =kO<V5]iڌH{`w3{|))onݻpk0X ;毝S>^<eI8<I %Ҏ^tS쀖zq,Pw)"(7ץYձ-f飬j*#!Ek\JfZOr/q46N. ez. ނz~V0U"(}{ۿv`S1蔚lqeĹnI,EZLSz͠MB=h'WBxz]h?vXʮtP]0HƙȰ݈ÎSSH]آZ]yd2%* +v,+h3UfM3_.k?Lg70/`Y֋K/ )VzX54+>sط.M*]7^ "uR(,%#vx04e(*ݎP%+ӄp7H f>8TZ[0'@͝3? >xbHȷ)9RJ(ey ?&hkRV; qkm49V X/RA=B$g&@R֪tx"w3sXǶ>zp z}{=UK`* Y{< k9%pY36F1I )aVc;Iœч/qL>X9Z@*ADx-04|F.lz5$t'"R)~׭/Ԕ~H}> ܝ..= [gۛV=' g֝k"M7CwN ,M 23p鼝P}k&GY}үREf?OHu RJT`_؈J[NAӒ'S3骹jCֲmJDj=H'-C ymTx1U$~FZۥ8x4ߐ"Wq~kane1|>H}q;wAb~U~ *ՙ;qEµhåf^P#B?8z 4pZ4%2) `\A5 ݑ܏^51kDuA{{&&P\.]1ob!!4) N HCkӍÑAS}X!}t̢隷~jgºތ욣3)[|q Qf`:4nOD]!Mm!nF³3줡yI̓_;!ɊIjR$u1yob*!5;pf.94g÷mFkRL (P\j`10E3X$&\p; j)8͖u@)H8@׍Y<4V`4sf-Jq; H40Ypﬨ9yzQҘ ~,iTb Iø KR]=TؘY.d`C}˅29s\3!DjHD}s-A&5$},)'F,_3Y`^!2M~g(?IN M[f7į$˳7}NߺHa|+A6~@: ԙ(lsʚK5oiJ́Pi^̢VDwI͙;w~]N(әp |;R~GSXY!1Ťz^5r2X:ԧO^#; +Gs gCiQIG<ߔR b_HF4sV [A}M?2, uȷQ|&^PjYe<`֥DY/u#+̈/G2MY }EEJ ͊z W=-opגH!o2[% 0K05f,m=R%6S8ԩOp\:6͐<FZHPxsEx|'Jӄ'Du) +4չ*&[-&NlZ(<` '$g>+r.&E{clfQ i*oAhDfs0`='4^1MFpہ}K5FvM0;?4#,@̭51uwk2u?eQVR@hl".-ڈCXλ7w/3+ژٛ ; aUu!2@$=PM@}٠h'>l^C 'L*lA6{m[QV]2 '%KV=k\[o𚍖^Z-UxHD%2űʎBy4$ږF)I76Hpe pӞE'6LOe|JX4v50")=څ$Gaq77؄<_B݃/N*&=;;Pn :L(<1! :*ZmSv7K5MNeqlgB[i16AG.gIYH0Ksõ֪lLp:F votk\1V{φYݾAspڵB'}On" /_<Q8B wL!7h)5>\u1<]*/ $ȏqǨ.&%D? XR}\D!N` VtX5H*>GςdY~(IM[ߺ_Z9&*DTϵ(5'rK?*lt$]+ BbHݜ |tJ,'\ ">] g쥻K.J虜O{Lŵk}4d>߭5W߅z HPо:'[BS k嗹W\Gi}EX4g0Ór/Ա Oy3R?m ȝgK(?o%6;j{Ʈ(;;"e nS:X~GCtck, _Uw "jør$ZܸS ƞtEqT;4wzprVzȐ9pޯpQGG/nr9h@I5 _nK©65moXm;Fw:6%TYWt,~e]'K'% UZJO-7z8.n7v eq*6Zf{ ,b"gHUS2w&|wN(!Ib&IrvQ+E&6Fᗽغ X)eq8tڅ"fgE!1j6NoXlI =ffHf p2ȷ9`$LOi4je=Z{$ٲ9sdm w?{žJ_[ \Ed/x&r^AAv/cÒ]_$ty 2/7d__ek+mr<:yRh{Qq#kEgbUFP#-rP"p&(>asy2'=kDpAnCL/ihة2lܲt^iPEuӠxf/wCp텕Q^Z>(ǺHnGdWSx _G':5]&Dm3kR?IRKTǓk>^86+G`.x}45gNOz)l.{i51ըE֤ǭJ]0ԣx' Ӛ醞k'[Dc1&hr4m_%P~^QiB5VSwmqHX%&T" (Nbg/m dy=XM/svO5mz( clwY˪N9{Sص/6:AڄT…ؠpF eO3K(X~!,yW(T;]]eUY&nNS,/^<bPS`?FcW%5"#tF׉0y˚VYl8 aބ9Z d bb4:#E+/Pi:J˶j,f™NBoԑL$LF&F?ET' 6)Ţ'= PˬJ4Y29R u]DS μ, 6߅л_2:+UX-f'>7))յ}vzY}}FJA>bאʄٵ&B\Y%yy}Fϙ'3H^\߂.%hP w\(]7픭MRfn(ӈ6DŽ*SZ>Vweü?NX5~2&1|\ۛ!WA^$rѾrT-C "Z9{L7G]tTh:9K rդBww\kJ2L {>=RU/1.IgDAK(j]>2-5<AYvvX񔗶—oKk^I#!r5tP}}a|U59yH;wW1[z \ti.Cx TNt\ tOvQklx;1V9`)ނ7 0m2aҜזlƕﰫ^`Hw}Hr>ALXiJpNuLn!;'P`P#^Fc/- 9>QWk+fU  bs„tUGIR9ly/^Әک6q{sfg ɵ)",D/&M We'*" b;`wǀyDj/ M KT;bzvЌ`$ PQl[ OZc?:7}40!) u]}]?YĚvZ] 'Ϊƛ ٬^o/õ`H8B'<~"!$AIyy NY/Y,.5%@dHR0>vؘtͿeC!0N_.$Hc5CWY ':%y+ՂY!gmZkq&qeQtDkg/I+F2BcpeiRZ|ea#c1ѫps5HwK%4& =t/BϤǰ6#G @vu=q? QyjSsW*5-&>+S ex(5r.(g1Pn939.d2A!mu~#ivc8fC+fSSq@yفZ:h6 Vbc uda히[,9Nr$*%/'-\^UoG&ZIhiA֙Ach9PD z$y 5ڴr8M캖EiKMk)E"b3m@V>IoY.(S0GBt]ݜ}Œ nUMS)Šr 5_qt!pX pbb-b)k,bK=ʠOtqIR#ufzK݇qnTzR1Mz\]85V)2L de48.ܫpm{IZLGhI##v֥6C;#-p{cu8B',DCC9H,{v/Z,Lsj.dh0Ur|иFPԝd\m4_C9;Xi~џkؗ"DY..|-ZC; ]j2|V<ֱa.>QE6 }1Øp qbYtdXXy8T9&!d2+Վ fZ;D_ .A:' ޚv!H1!ևY1C3⨌Eg661W8%XraÉ,v.Fh.g1ԉd'^`%H~ˠͷBH wJ]%Kx=qX;{>b_[uk_lG )#|3벘"ށd?[Š`rr;R@ip㚰 5ⱴ i.;Lj[؄%+3Qem`z`w;~KuMp:z z2mY|p%sI鄃TמW$ 1LXˑB^cBi?Ju2;W[9: A4_Czʆ)#{ }}҅qCA~T࢘sOYd~^>_ NоHu7$ u[#豬}M#:W4rKЉj#K዗ڛݎP %\Ђͱc{T*vGRvWluu-$MTfK`[D[oZ!~ Q*{ax&Bw&82Z.wG~sf+^*y gƓ 7(?h Ż5g47ПRmoe!#E[b$ D)6+&%2b)˖"󲰜:~GǭX5ed[$68St= b7|a C}4-!JMK) nְvtP8 9pR3 ^38ƨg; ɂE;C:J3QRxZW7lic d4vAh9Q^,RJOeܘV݄X?Ec5 }vSWB^i-!ӨG 9?{/ e =3%MR|-L.aGQi&ɘތASQraG1J0UO3xMЛ1ہc^Ͻ%L jܺHX/+ /c0oHW)"6Ѕ\S$-`zk1 &@S賸e(P=ɷ^@kD30 rF3UȗVP颪EI؊<2NC   qv~/"g¹k CPo|{hE'1- iDž(n;n贌;A΍g!;C8V$WxY_7qz3iqR j7H}<?ocGTV%q#n˟Sk>}3:]dr7-*l"̶ 9zRgիۺs`q|z(T\ۭSäOw0=SvD4a,@jwᝍf+ON*޴yxYXr[--D|!p'郸U_luSMqk۶@dwhXٻ!/ ˣLarGuSsI412[9S} ['0PJo~f Z']?#Wqe xwxEm ! z驧 3~!Lό 4- .3SR1!/Hx,IEp θC ~%0FtX[J"P>˻wr$ȮW}2VC9 (}'u zxPT"|sdh 8 極~uF>YKǩF0S -0okNwI4jC@|p;հEoL,J{[مvQHѮƉ-CpkM#I।Tv#a줔;HԦ@eUEV4lk-+w!j[u*X/Pf~uRQtڗ0Gal fåC=/K]cr6;9`|n)(a2"#L\$){5P)A3;=h]/  *}j, ?'>G}%dNczPo~vry6e.\DkR cҏ tz1tyu(ܩiAA FȕjC@䑟;~3 ?X(!T\{~P[},0Ao^ytA^usX*\iZ۸>Nyfvm^,tpu[t ciO= h.3sUj".h?5zj,,~~ênB$4N!ya{g!myHK?Smaw{ci g"EF|AH܆ew$NKPdas7Na#7svT??ҊlYH'DZ^w&к#2Mfǐ:۟$ o+/ODU/Mܿi<讍v\Ҭ;n܄ ncZ_{ pn}iTj&FsЧ| @kfsKN-)\{S C~p(FZ!x7;$2GĿdf>}+"P9(Wio.X+8%ugG }IV.w8$/ݹ޽U(?D5SIoC&1"& 'AQ3/:%3V96,_+ژ:d9Ǖz6Ұ[O3]OL?k>_Dk I6549P 'x]ء&8>MM[/"($^dJ9}3׻M~]%9 Vc]wX+m)@7ˡE(0YRT jx8dS,2a-uDE$vͤPc'^­)W{9鶂NhQkk|J}[ 8ig' f]6[MAVM@H"ˍ㓚Gs N X[RX7^%ԟOWlF=Ug[ofz`a\wt[Nث C`C(AjpjğD+"8P͹qڪ\ eny$?6&K\%Bp&fq ':BغPLCA]DTGn# hd:kkQ?N 5Rf-qNie%촅iy GNmeI:ϙ_CѰ co a$U(!_@PvDH[k+667[]"I$jf $&5Y1g w~SO y٤_!:Gx+_c "ȍ_@`4l GȎSH4 BlQS݃(VUIXq/A,5!sb!ч:3xW9 0_kG7鳔~JyW%Z *(j ''!V6p&XJ@6B~)pYZ?!3D E?-Z v6 *zl!ࣟ lrn3;Vr(θ1R{ѻ%n{7q" ?]zxVzq9Z*W p9N/‹ˣԻ O$m/&a>R[y${.btC>CZz-h@w.UO\ַg;ya0&L/^fI؄AIdž1+Onjوqc|>-*~ჷ.eH .yW ܓL tUuw(i{vImjsFoA(WuH%g"@lifH^DS1L86hu"`?˭vd߾ ZWӵyOdUvڜ*Z~t?=9;/U4 =E}V&x /R7{Z<[,f)KAAe*5ѫaGA10gV/u _M"Eo29ڠLF;G!׳i"Tt;n@`Q<,ݛjba:@^P6 Z]({y7$:q CE"Z)PC'CB<h_X3ŎMXINx}4֑(탋< @D0RRXzQp-Ĭj4IA6֒+lB)'vrbxKӘD37*L}3WF}QIyyOPϒM?beg@,X\ɡkmF\|vP[)1\@b,mSG֬KNϝ [='Kt\3S&WӲ\[[ո՞bL\*oˤ`~U'";jt&Kb6ツ|4Kt;/)}/kr'`lbнÈn]Lu teܖ/H= oZ~Nފr8|WhH85wW+b9R y"_Gs }4cHO5Ct@U=L[Z[ ^q“9{UW\粬fMp$pRIVqBXTP+Nk0~>jUpp><(fy췺b󶾂=wezQ]Ony$gH𸩞1fXjLI i;őTQwO2m}FssAYaLsK 1OPB)HtxzY\ܭiC%>1¡4SL#S]H< 73g߈\ EYAa$SqF7_j%b"*mED~trW׆LfMsӲ6MN=`~#2DYp vlHp|D103[-2G d!MMt9Snmi1YNݚЋ~8i/@'(S&r",?Z?J>VbOAy9cglI9D]"5m0}4 =?%<۔?i4nA noh߂Ԙ(y`䨉V<(;Vw=F qt ITg );B8缡I$n%9jNS.n1_e<gS\}iI-t^:"˓sd+˷>\ I>%vTD0@r|Ucn#Iݮ_-;-Eԋ r|du-wIL" ҟ3q[n֑/Ƿs8n6lȲaICw^dT喐urk?h0@۪T{6l+o1$# Y+WY$q1fO;2hI88?HA!0 ^!x)O2J}(VN4B ?m;?H )ZRuNǝXOb*\3ap~H׭.ݔ`m&Mu&cs<%1G?bV?2GzRS[! * kro 9,p[:eu>e.g2tf5?(dɌA=J>7&>o{ nK\"ĕ vT5+=Jѝ7+N!%T[ayi z;%Q4m%ދ},Q]Mͯ1 &*OtAR=qv nJDd"©C*BR!ڜ>MLMkfp:4FXB*YzU"_ZyFg^ _E6t'PdFpdc]ʴ.BsNaJ8mIG@ǩ΀S8@! w4l%sTs'/Zҟ]/PVEcIoLǪfdչ"@5j'drhC"(ٱh׾7. VԷzM@ .;3֘ zZw2>LZ܋^Hmٰ} Toi,#j̚߆Жqz*&?Ў' 0fET=R ZijjSLl7*+]1E!C_z381gr7'Vl7*@9}3C3|9(}~k1[gp1ۆ;obe1g}.EyΨ*x+9aΨQP27EDr ]&!nE:ApLku;8W'A\ڦXkэ7F]ڝBwqܪo#6eRp >4]wPa mH1C%6?fBu1 >T¨ܚ;X?tE4rrj 4\:8IQ>yZ4K桖B㧉JDݮ*0X*VĆe{0O6A] xego&ֵ;bg4V̌˄wk56_~[ۖ뵺nS5Oa:k+'즮80e:PQ#PVJ=6.bÊ]9g\E- @q Z[ͦpY咧qUR썉İw>--a~s5TH"z LkR^wǿ)<7Quy8;X!)" nDfx/c#l|@:u:!5.D&NjSym5eA? H+"'0ԆHMvW.DȶV rtIUgI‘"DT*c]OZ`p1)pBn5J[$(-aOkp:l!;yu^:" : ::Et` xb}h(5w2\ & aIo ~6-* vV1j RisӶ~O3al %(ʙu\:AHj6&`Sc0UHݪt?^yEoETpJw4 7 қX(9*4S{88]: 6rbԢBcЩqL@Om"M.|KQ颟7 ~R`l}Z&_Dܺw`O=? QgD%S|ᅒB79 hU dz.#S~r̆Xީ4&ynby]N8 -#M^-٭&|0T难0%ؕVrHܷsSOe=j_$p#Eg-?hxxOx4e1W|dO{ -M"%~ȄWdOOu[H fZT;b|(>QOudnef:ʼnHpM笕\q[FmJQ# KtII;}^6NK޷VfyR7t~^ /Թ˲;zQQeJKYߺ 7my]=*;#` Upkzm|mH魌0 -Rm/{Mr ocNpkc}%''uy@+%VMP-~|)p^&k;g[(9# 6/=fVNZF!"Q W֓$[R Q<<= ]BC. ̴Ԭ7z8v:ʲ,y{@`tE-n4NΕ m/O~3|Уֈz^X-&=vCPnm\ª٠ԭ[PnWLZ.zf?n|Wޟd*3m1Vq"v^DcU^u)y+>arFF:1KHgCXKλJ8b]΢B"@ݡrz㮱ʒ4m@)L?nр翂WmI$s x81W,b܋ =!6dy9K۴%'qew}TmTH C|}i;a_/wv(+/b!Թ6_ u\GY6Pߔ cfP=><,0Mi5㴽GcLGgCLe}hbSl8\Bs_h'v'~)t||q)F 3Pa,SЮig|ލlҴA<mF!axywuG)`|䤧7q!0y+Ef'엻pRs^r^~Se/?=kqͼa,dQXhLa1\xL,Ol2bz1܎}Jmhf~H[)9EUޠ22u%::/HNKOe7.m:םsC 0i6CB4ɦΗay_ȓs!/]ӆd`Nb`DY3ǞsG\Yb֕엩Lݝ=W(D~] ގg`NPٖ {ep_dd=NަM W;CIP.TYÁX+% y||ڪ^6PTiV-}7;S/k'Qj-zN s-ȌHOL_S^^/>UU [WhUGSZϵyoj{&* LWPF+]]WŻCaW/?L?aF8o Ȍ'/wG':O@JG4OG.D%33<uQ1iMdx4b_G0NO{DT/--ArXyw`S>v*&W&oׇ /]n>z'fulcT޲U_=Om2"v2,୙Q ;rjSW:Tygu,`d,T-lby|~(l7b8kRQz6cjGsѡY=yΐܿgUWѤ KL|TM*a[/mLSg?˙/:n"Jb3ޢ`zF`B"KɅ7zM٣Rk|i7v,Bu_龪qUW2 /8ǜ3)$9 *3x Ŝ~F"Mc,9 Z[]q@EᙩHphnƠysqֶι}L:uD&%^pg2ƽ΃^[T.?iǾ5E{K)s?ؑ>  Ж}3*ݳ=[K:sUZ+p$h 1!VFyfkM)M/8d"(\S(%m3dqy~A˩tHS8$4d9؃Nw%n?oId(CrA/tDţ-!_XH~"{Խ^ב62dm<ܵӆqbYZ"ˎJ)fYw0:[ 55e\B3B3ʉo-ZG#"*j6;Z} NqW|;V ퟌ#T eAB,7VGjz:꼩g$Y&{!YBcaA0oMϤY"m2-ZנdܖGNd%J,9k?6NB[bda_&uʘٲ6y!B؇HFU)R,]3<uQ$/aYLӞ??G^\l}waAV58$LzLatW,y؎V$JJM6#wboBd1 ݐSN4er*,s ć[҂eCmJss$zM$VA)5vo6-R0Ɓr}jpwkK( O޲0ngZ/i3&҆l[_IUS>GFF`+fጻaЩ~_'< |+0\;,nj ˜xG΁sd(t"KA%͑\S-fyZcB+u~]< ^SlEcA۽J܋D x5*==8^@A-_ '`*n벖}OLgvgEf(16p#"|J +fyGZ"~9gbݩ Mt%#Yo:zμ^!6T.20/Eu\h70PM?[CH+D&U7'fݻh(SC x(4?Ҽ7ۢnd[j&V ȕo R\pi8+Od0/QZ]aO^C QhV0(8o[hc/f_`a3:CLHShfE"8UeDVNP ^xz/Kw#_+gcW'# 1Os,teHÍu*}1ޖ28G'ȶyB3CfJoߕnA׼ tٮZPpK&A>Ϭgiig8i95\[wEFAǿj߅$7=*:~D?U誇 ާ-1sg+"Ge0i5$"&a"͹BPpL|_]}U"(kțNPDU63嗚n'ں%6l뇈rt-THs>EB<_ ܄ΩJ˴]ṡS+fnìY5 fDBLj sE*Ϫ.Sj5o}Y7c/3d9=o%JXI_Neƽ@B=//^*ns؊7Nm0tȜ!緁0Cv*tgҶMTT[b_*#i"0l(|>RHkF$G"+k!F78M6S) xscK2  r} ԩ%XUxIVf-ȋȕ@|3|^9hp?,7Jb~/S$A˯JT^*Fj{@f4ZUo0#&H ;`[r=~-Әnَ.S;=UbgtRa VREtؼS_Eί ^5!ؘ^`z$'`lz)75mHoJOxCÏsܲ!Οկr6 g"b4d:{_TQ@̜EU9]MMH3|(eCx\UƱ̊璓E0n@^h ;0CpO u$/xXIb0g~N5/c`( 4wC|%ׂ.0R7|I"SyakC7|_dI|QF1n; R/Pj1PoR\ڹ `+feˁJᄪJCҕnF pG}l`h7OZ;f_9kfftɘk!`r;8m4v3 sb߇aU΃sHQ3Ŏbrm_4`PjdAkx[|I9ϑ‹-#Y:_8Ab97@AAXGKTmj8Z%D< ]])WC<vP'拹b,0VMZC.8x{-ڒA!7vT}^ĖNS:e054[w6Sq?ur:P|mt\zAc&3qz]IƢ3%#(f`<'Ѿ@(\%,edkl#sjJ_״"j},׌o#"}֞T F3&(Bi8=?Ǻ  7ItJ q_I|)\Z^Gozq_ XMyЏߋI fe*Ddk䒖dg=ԛ6J)m ༦fXF++7˗tagPV}~U/rȰIt-h2Lx`VC>jDDeFe%SN |IjO 'tK1u̲M0bXV=J(EZaOWW>75r{BbEyxФŕBė\e,B^AVO݊SY yz\u)@7@bx{dN ^?0MR3MuJZG)`ل(1JE>% Db}45hc߁T>m+h=rv߸ ng=:BA j@j Y2Sv(؏)ىJ<琜6o{*^Q>kQ9Q`[qYU; 0jEi[/krʮ>% 4LlWm1nհgg'?W, ^N d8`\dLEro`*%:l Nkf.8k( M4e4:ʯ}ԬۍX9jC#̠{!9ްVe)$.bP"4 z.gVu eZ@McSqD5Qk[I86)n@^1ἊsR߂ύs%.;̻F֠}\HFZs.m9_ Px`' (Iь?XK6*WsbtԷlԂ$߬iF"s$W "Φm$CWZT9[뢂?o$R7iO?Q9tRzPrZ A*%ofɪ}p5H(_hOf_pيT[\H\"hWP&AA"g!Yz4&|4c\O1gN$J5G˖ub `,w׻V) IwG"B 8iAg5!,=i#dfVp2;r&^mOUBݔ |Tt7`xķ@"QlWcT'ZJ&Ok} bXJsCK#,mH'H  Բcaa@ˉfnbRS~aR~zJ2ğ=hmgs)Y'D}2ah{QBiQi=j@;Fd4~DW]xq_raZ~zd[їP>RKUM14D_/Mxޒ#מV(ZZ@%8ÅOҸ#;#\~$Fi?/[6P:D9?,1t# _L~Ixě[+#cقy'W܊}sllί*mWN[GSIToA~AvlSjF#4F+bKУ3 AdbV@\:Š/.D&˿&m]L2B=É!QY",lf>L70DaВIsx85@UO3/oq(IjH4-n]UeUag~Z&.bח?z)鯓xt! Ozf-DhcmnVgNS`,)!BI?C/8Ѩd$ץ^^Gu,Z.~@7i}Nxš}{r먕i( 5yv _伬6OēsG3iuDh>nvdI[b+~Uhy$ RnbV$޵Yf ot%A6MAV<$Tzo*k2leh@dfXBI˫'Ik_KRu[A{ڦ]Rf2R@jgO9۪nH}}Y0fRf 1 }#ȋ&]T~ w<%wnfR($Sڕ8.($ `@++v|/5x{X 3Ƌ ;ťK+LZ} 32%0?jNǩNVޜZ_$;о4*$+(z-mc=ɓǒ\~P֫?mna2jCPFՈ{an (=.n>5\ٮ<ٳw\H Z{񽔶-r[ kSd0ewgVԾ9Sr$!ig]sRʥ',ʖ? agDPѶ P*{2[A˓n~P rv0}mu5zL`M[YHpv%r[9WW_Baz y$arIBm߆^@Pyђ4}ia2v"cQen[Y9Ԃ.Z`W&DZK1(È<3Y|؎V-V?]rILܟ &u%#irp19;)JLE=(=h,Ҏ\4STadZ˶\?[qj'7J2eyh=v$|[JV-@=C7rڨ( zOӧBlu}GN <a9c2qwql@\+^AFb;TX:M5WVsqeޚ48: +#s 3(E 3R4zֽnfMFmژBo-pa;o O׋[s:W#Q"oYMafuW[6Ε4:wo$PN]zK|=l[>b?=&𒆵ҽH:Lo_M&}ߞ6HF(0aye}ʓ7^kfa:@ރB:3Α!,G" YZ