gvim-9.0.1040-150000.5.31.1<>, /c3p9|S|kK$\VC_'U_GG J ßh7 ~y֑<{n̬tZR,x`Fޖ¼#џ0ar2J`n0$7ؤr'cS2l^RQ1|1 EJ4ir6W-("}q8ùI=iV-yMB% oȯs~6F< AL\7xƟ4 \<+:_OQғpIL;I2k>H?d  +8<LPi U$ \       <  * X*B*(89D:>@BFGHIX YpZ[\0]^} bczdefluv wx y0zP`djCgvim9.0.1040150000.5.31.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.c3ibs-centriq-5HSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttp://www.vim.org/linuxaarch64/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiF`r C&F,A큤c3c3c2hc2hc2hc2hc2hc2hc2hc2hc2qc2hc2hc2hc2hc2hc2hc3c2hc,c2hc2hc2hc2hc2hc2hc2hc2h0fa3a73b860a3b3ea72a1c558b893abf710e113378b448aa35f0b586af07cb5c761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820196946503aad0bab7ef3fa89e74f9fd44294c1ad24aa6ff7c1ee428fc43b8bad970f2d6483d137ebc955e26b69792aabe094867ae21582f99c008a146068fe50508795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0bd203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa097f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f22b498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.0.1040-150000.5.31.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(aarch-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.17)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.0.1040-150000.5.31.13.0.4-14.6.0-14.0-15.2-19.0.1040-150000.5.31.1gvim8.24.14.1cR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedibs-centriq-5 1671443429 9.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.19.0.1040-150000.5.31.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:27247/SUSE_SLE-15_Update/1d8bbe09b502e3e6b9711a0f720dd0b3-vim.SUSE_SLE-15_Updatedrpmxz5aarch64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.1040-150000.5.31.1.aarch64/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.1040-150000.5.31.1.aarch64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=796dca571685482325cbb78801d60cdfbc6e9291, for GNU/Linux 3.7.0, strippeddirectoryPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics imageRRRR R R"RR RRRRRRRRRRRR RRR!RR RRRRR RPPP P PP PPPPPPPPPP P 3bۀ90zutf-88f1b06b620b2ebf6c0161c2a7cd83b460ff7141f1b7c6c0896634cbce2e8aae6?7zXZ !t/$n]"k%{J #(\p2g@V.P*X5@vU.VFC#B}ԶE)2nJ.8S)|y?6)zI z@L1\7LrY]˞!>$nf}xԗROt%%۲T)#%KrD@"-,C+r1w$l p%'Uk[+vʀ } R@J4^KK0()\MvԞ2u\=_vB)5}=J_Xq[ˉʸ lTn/4JdkyA #!{׼3ͼgVMtސ$m3VU9*b@L?D"v73_x!}_ѩ?֏6&Z.~p޸b&~j"ZZ'D3 =.4Z΢NNDRv$-FyJ'S L*He,B`-*%Ʉ<ֈgOkRYTTrNJ, Į6o{Ep[х[%'-9tdG p8y;[_NG\QE9r"Q,Y#Ԇ6~K8Aʚz[29<(lY4x<;#)N۠b=.vxu\]'*mjGn!x7:/rX3 [ka]~'hTFS5Za zʾ@1fS=<֒rG: r̃7=Q 5hL EKfپ4Xd S -*4  IM'd.+5@sᓑ5v^M>?hir1B4 |vrsgBEwo%< 19w'U*hٕfU$G u8!4ɲ®qwx8EYs ."P9H ?2܉81bY%.;{I}pDS&ifrEԠ[-{#>Lf|+m+*w-yHK8ۓY&k>iwHA!qtz|- ݣB|)J]w'wlyR`5{7=`\(HKZK E%تtE$:[2w:"Z.BZu$9GR>q0޴65'r`5x%P5,RՒtqK.jhgo>uRW}tÝE&@ [M@پY @t]u&:vcRX#I%hԱn`qˎfپuxcAgFGc(- #90RY:t\.Q*7%"a\t6vsH:x! VCY;~Wbj! ŪivLn0[#:eJQgrrF8K) JQ:NvR͏W>lH8$ԩP? sK~W?@1$~:kEPi2Euet_sñ/i3Fk-ua?{:/gع JF\I dY SZ5Q)_2`@Zp$Vry~[|dN_anA~<"]Ȟ0L*j RxKx E\=O^Sʴf-_]y{W js,'~c'ZB7a);Y$$h dYk5,pid!GX)/kf l:=[Hsƪ_w`ga?" >bIOnP=JC$c\$範]b5NKLg w:x#s9ՠN䒯Ȩj~ʨX ܫP 5Gj {\jC$:xJ}cL5Z8dƷDYdXR#tZPåTRcwZvwT14`{6߰TE$N obnOuN036d{0 s*ߋvě!nŝ(`w%#H₼8A`4=FDZ>&1F'@A[~zs(7h&U?cQ)II;瞎T oP #٬ wk1 *9U@XAΚM}Ivso~#tG_A/:B9GeV1 ՞FY, Ҽj C2_nBZ?Tb9B;K\,2+@si~ B;!kL/ۣnHۻ)e'!R"u!BD^>҃}|6 >6aHP UgL9nW;|KSn'_G:>g6BX(T-b Л_7^)?t.1pfT"/i :O@NORݙ P-9zGe2?>RcόH }j ''`|h.9܏ F5sf:BMLA3ET/zCaR&<5%/MeOOTxnաl-&ѱ (Q4, o, EG-0wcn }&{iJً+>c DNn#+K*զ"p?)w݊91 Mk Tܤ*||lwp9?#'DI"|Y$=Q%{?7/R7Tכ'q!"b%h } $~Pfqmݧ35>iD$HAM)`iרUtg}!]F~UNeՙ?wt<^e)̴@5v(8u|ڦg 9 p"#tg~Zx)0&&Fi&&` [<&9;NUˋfRԙ<ҤL<'KbYܳoqM[p P-7p*KHZbQO 6*1sI.KU䶍S]|y T 䪵YWZ51Bt}ݡ"&QgğV6Ld91{ExZM]ILo j~$+keNZK[?,eR@X8['UkYq,LlH6oWHO>Tz{憓оRP9 02{3gy^]^%^89WD0hj 8zB <_4vĈXe sKQΠqY5-a8&ēNT3PZ"!FX=Pgs:rJ90[Q=FYbQ:5;tjdƬj^?l:t=vŜ )*an0ՠFߺFූڼG6pN437Fm0G݅13}ZĄ-eńco?=>{U|7뾃ZVo.4ox+5ʚO0ҝ[}N>oТGrY9?VZ+v{toW2 W:4VLQŞXwB\2!7637~[ ?\e;r\Uy-݂~"vh`QGsnɐ{:{?S~ =v0t@d"VЄ9l$H:|\q5";5ͱʐUh2iзզm-݂*^4'ڕl8LnDEFU!Ypb~*Q;XhqEgՃZS%=#m*dͽF'H7ͩA^?dC5ð܎Snb40*3. U3~yf3~JYAlg^#J7:?F+6.-*0QvKv`..մ(1۝%M+ l7n! G1ꟃLy8t% rY6Ut|YK΀w  v@-HIW^";((tRQ} :ͣeݒFf{ҹdf^.?[ 3ң*, fr XHKՕ Ag D74xafK]~Uܵ 9'oI]_1b&eSk6Nn#"cяsU`6R^MO7D$͋+Fo}ߔk>R6r~:Zk:_j٧`rZBPqE+J8535=EH0-RPl +E/IF ̹܎tkO#(X j㦥 ЎђJ0z]σyICBt'1Zm"L rdݚѯ*^=D!1zSL\lWsyRC=}9/Rµ57[B5]Jb$v& QBNWD8|i4Q@M  }2}ۭOlb`BU#|gƯ=uJ:*,&!%\x[TLSsVPlt oA\O!$M /˗:Tqb[bԗkSG-οD"2޷NlQ^Z&ܿ|Cwþ:!ٺ9AL 9|3d¥f5 kCWeAs٨ )9]8-YDF &V22_ y͜xM~S c[HBHSK.AU\YSq}c}~ {)(j,bx Ee,/RJw`8 "xjG,)Ĵ>OECVh1XΜoY򰀯E%}{ }y\4H>?U9E7?M#ȩsC)H%}ÿH仛+v%aY/Gn7A:=%EBʹV^NS |gF@A%`M?4r¢!-vm>W3T':Ì*XsVAEZC0-qיtO~4SS }AR-;~pV{tBOVM)!;3D ګpN ^({eAW*>B*1nsЎis Ji"r"Dl3: ZpU39^)]'33*vQ=8&D}+H):ޟRS(֪ذ ߒ)s_Şr<?+ /Zvf\L4Q,DmK;$^˜_{gdA G x) *ID8ū !B004R)8췙ȩjBn͙nqaS! =*#`L<0ο\$ . IwJ0:Ftԩþh7Ev@1UfEwVf!IasFv;h-pDE?ɳ37mơ)|`evf7)p|{JF%!7ցIhN-9Phd,^~iJ9 x]ӐgCDQ@e ꖨ[mWV՜&DfœsJȸbFXƤ/{4d1`[V xC+eRcW?2mǨ1qM'AsvW^ sLlgzX6l bvx \مwSeƕk>^I&sk#\w}FJv?/<]8\{儌Y_`tv6 urҕ) -> lf^T(J^.yRdA]CI;t7j fImuT<,A0_!~ ѪC(¯>9I\X+7 Z@( ~#$L-[,o=$u' kEOC34w< gSݟD(RpɵP"(_dU45]#b:QTXMC-v v-E!:)LOj v<Ų|wrP:"c#5e M={3͢S"Genpł$?jtTI50E" 90Jq>MP!uChA F2S@EXuMnA/u]vNe-o1=9rXqBO%<<1,HJkE`)ao{Ofӡ/p}=W0x7xX<HD'y4kW^WH6 <(vv#.O5i$zVJEq9dyS3jTPoNB%[d=9р=q!5CAc ɋґxs[i{r6v9Pm#hqn&&*_O[Ywi!ֽ U ~{.[ȻNʿs8P}fv4Poń },M"H0p(QQkng(2>Wm=*NPP<";p֥.6fMQ|0wz7}1F)wny+ Mf!ӨL\6FdJ5&gjaU4eAA3< WZ=,x⒉RQ8]^fn%WM2ȳ  ){` 3pS^%?LܳPc{mapBZhJLT oZݍ8AyGuBp?Z~^kNQ/'OcA.ܛӥWԌfQDSEz7q 9+Q<0 N _|xi ^~B"}<$>Ow쵳 $Hív~s<]a[[v?FV EkI#7wF1 TEޖCglwqZ_ x0w, *. 3A׬-HVhEr+C`yV&dƀRVEYڕEl<:zP!ycKyz$`٠ ?g_/3Do3K5B%h~Bq̚ѝ_^NG,Sz#]ܶ0΁1p.lĴQQԊx&.j2o2|:Jf0+:%luAǀ zW9C؃__!GRwPr˃0jN: x[/ [%n,~`=$0i!{,9F@\e}}<xFitګ" x^r c 82hc>o0a焕Bw;nK༑]Ty\tu]kMYq Ty2و.GE2`]e֏Ey~b2Ѡ! h%kB#glG\8@&#UVQHo6ւy]bn\}*8\.DҴJ>fQ%E¨-2l5$gF_*NZu;@[ OD(8<XF|Ft|3Y<š~[Rص:m3Y9EucADH &{rpV}fa]O'U@{gq;o2'ύBh 0| `ƢWA@:,Þ^/mό2k4{"];6W~t/H/uyQUb Yywo vecf0CCV''CjZi;V3PoƟI"Gk`hfPﳑgjFMk BoP2hPЃ1N/g$]̪a/:qhnUo*gϮgZeXn^WVM/p~ 1Eݜx7o>?8> Q;f ݧC"VRIjG s: kmg ~!<vGDOfWpKtBD%l*S /5EP. {@7޾+8c&M(_M$qbK7xsI.(wNٵ>gnLsp>2a2V2?`_5aã{ݷcvvaMM(!dq2$p?jooޏbJ盒\=.(IrRk QVJkS ;%.m128͂{坩`*g uE elf٢C(tY.TqͰp{k]0~ vQ7{f1ZX]JhUUb"2<^)a#MZx1o]yE ߞ "="e+ `2PpJhȲ k ځQ*I݈:WۗZ9@P͝2\iJjZMHmϷ$Et#R8*fM3&P#)b1%Y~`N%a~b&0M@G{ҠƇW/jIZs-qV7K "nX?8곈Pq!ax8MұD7¥$O :ty1\-fDԊR='N@̛,,0a3ɴfsul^Й\s^f"‘d&|>cͶ1._KܸbEThslrN*ݸ-DOQ Npz I&+ .l,uX%4rkQgjep15XIV/B ʓ/N!\g:v_'\s˱@Wj.v2n$žFda_&i@-o\t=N P q ,K4 ]w JZ>e6Zuy5>A@rkSYDA%N9{煦VfrhqL?u7Ƃk", C*\Tð Q0<״KpI> 3߆wx0Z\ep>IpÔGWLܺ[-x<:#A-E.#= Mb(A ݩdOG|e`,@M`xrBM0ŁQO5ߐp,(Ky![;]+G?g3?ngXDeȡӪ-ʕ.鄌L o6f/PF%yhbPfpnyW0OuEe/\̘xڜXKw+)39L>ugxRqCl$N9Bf=$/ڃ1 Js y u$Tk4<]kփK65hVd&:&;hϵ8_"I3J.yMhRB7 ћxs1 ja'qPܘ|^l'. 6E%t0 +5?m'Rwh[r~pqiƓ*KgRTKF9"e>je˯1O%+Z=D@CUٳѝe$3o;h]F@WzRRPՆ;F1W?RӾȀqQlx 1y_/ows7:K(r^ hTD IX{i\fv}ioi}dOD1izU?Nޛ:̀cGtnl G]}V^[VU)͆#I0$ވBvQ{ MY1Y[ۆGpxD.DaFBOQG[캇_Υ.zB.OVdKONsPKyWy(| hDCa$b>=G{. •PIleD#>*H!$\ ,G^{j34!Cb; elQu|G- _]XxXؿ_wU[ƭ1ׇG\ D9#ޡy fL)mC?,o+:⛌WjBL:o;)NGXE\U桂Y\7ʺ%@I}Z~DPWrmnzgln%μO uDDIIB\PShcG1?f8 $!a-U5#OCs !PkW,j&{H>]J˫UePo >q,S&Ui(J2Dŧl_F [JY%[V!ZmR\/)#{qۧOkкIO5?Ah9!0,_m-jdimGfAL+)?TfqYDS!'@b5]tQӏvK ȤVS{DQV8'4ts,@jf`GɠTނz%;Ɏ,f{q}jXЛV飧Y-^%h'$>5,}-l3ģvM@2?2HIj N:^ƹya>$W`\7`kn7㛗6?`~1ih1g72gJ(OT}<%, N;R4ͬ߱ZIfQ5L[Cn*7[TguAs=ՖwT]J`CP blz j҂!Lɹ>r{% lJ{`0ړ2(Wqva k-ZH$>C'b-:x<1%p!w%8*h;fP OLBPFC{\e٬a!h. rhדּh^-{C+S ۖS'gzJ!| bU Eoc8>,}if#*3#WD}*X&>޳BPxǵs30"w;H"RNrH_s ^tK{&Jbݡver=R*uyIX'$iO &3}|oM"Fz*ot4ޝ"XcVWRik*c)p|sXJ2+ 5muc;pjhQ4%U7y{(9.s$~ٟEMAdgm/zH@:F/ DQ7=Nm U״5%3(?,,۴j:\WW‹kW"ebuғO&kvNjȎ^L<(Wb}9>/̺{5|D7zM}ho+?L:v2Ev5FT̝}WlD /k[|ߞYȴ2bLw]1psf6_$0Ojb˭P4jKmK ?1#΂ ~%ϝ)?P{fr_N +ӝ2!I0@]4g atte b;s%EIƱppVA6:|2/݉C!8]|2ʿu}53Cl/M֝p@Fܽ>n`w-MR/adCbrKz<)F5&L꒚p-zcBRn"f($9du\7_qTp-޾D?9mK6\-Agib:V8~e^NyRF"JnGNGTxڎ> ߬_L(6ۼ: ٠ɜ:=iءJ<]#= pg? # =z1c(6Ȁ)["!B0'uIp^qx!4kp WV[VaQP\CMcC%.P!; T񥖌-9e&X;z;JG+Ӽ/>.Ȃ_mmkٓų[, _l1՜2~{ Vg ,4zE\If<7j[uxPu]b70YF~.6s,"c;)ELUxq-Ē']nj ٳ< S{[):mh-AJ7/{X0p^O|h$j@㎏n09M DOyd[!L%sVDQ6 l6p@ x{3{ {[E2v72@ʶW]?:`6 :Q+Z[KP W 7 ?h "uAjIьzGvMtiePQl A$HP<0#0աfR;^ed6x#~`%^誷D@H1ܬ.ՉC%T\3Yc4U J>~>If$Q F q`?ξ fҜ;9t۹A·|j?*QY` )  `dfRl(;b-d2cvl= Mg=K@ :%:VM3)gav;Cd)%WNE'õ8*DP"hH>V`.'SVDz$\p%>=x/x`c \Di hQfraKo|~yоV!"@(W}sNHe!JaWbBXqyOǾ!O0!S{,RB nOی6aXpb>|[_Zk)X&ꎂjw1|I_9eu87lvY~CCPU~Woyq"m4KI^XWIm48NA)PM ީ䙽P<Łr wv/TFF2b8.Szaq,Gf܌zCtҥsm!&FBٔE@ }q,Kmy[vgdY#6H.C=f2=,m SsRY+x'8yIP?;,lQQp cQ, -N=w_ &9$d=S{6}  ԷFO2j>̚V7 d=f(@WebnAVMBkݥsVD=r2ƨȳrH:QD"`qr5dpM-"xC֙E*S]UHߐɃ/}P'[+NY(TݠTȴ9bD|qO੗Bڂwt8[#Ry,ު:G]x`難}bȠ4IX3ķNFz2= 0,Q)ƽ։|&Nt^_mIEyMB LNB:R"Ytt&=ordzi%?VMӠ7&m'W˚RϚ~JNAÛ)š'f?g0@$>~=5C,ֿAWٹ!S!uVUAcFRXǗTgtݓ~j2̆Oܛ?,dÉ&y=m9C%(rLB{U;p= \dSp֩4Nt|; xa J9^Nod'T\v@=RĘsmu;Tq,_!7q"s bpB=Eh8*AM{^bLOC,oЪ]E X5ޔU'1D1Όܮ$V))3mP毤$8 ؅Ƕ8S6Sׯ?u/qrro@7aGZ\)s-Q0xتF:hru((q[ّeW[楬'ck-؏A{ G[%v)dQI-(Fy=>VJ+_.e]v[\>^tа_ ݟoX6btgC%7Fcمd5s+PՍZ08g1:.2RAvO!B9䃐G$pP[<='B/5 {1Y,Vfs^>0h(Fܦ9S]unEj m+CJCUMos0=fxMV;I)M,b07t۰M~ށԡ8k+N:>|Ph ?Vkmu6m%pc5|w"jsv3SLr ukE!U-M+ ]窴`-n z'Dq 9L+4o&F;*1#FϾN*8 ̊ =ܒ,Hy (YEȷŸ1`3J"OcӡiDJ 2A&>f@ȅ =hO=F7BW:4·GbZLxڦFq!Ua1ַNKvLvnx6 \kI\ly*/[>7ߓxb*)A1+(2QJF=CbFLf#0 lq0>u|Z=qل#@w%M +JoFpSҏIwSAkP :$E:*. 0鷆{ƢV 娱95X`"~Isw`cP6i0Z g4v4eg&g@@RII颁M" X_Ͻ\p=VH\<(|q [ݸȪb bk(9Gw{Rnᱏ%w}˕-84E[yLI։-+Z_28y "wJˤm_D]UKrh%s8(Jq`L!d`k%u_Ż} Dg9H ZGWȃh{Y8 %Ar64[jp%Ri^Gx;;'k&9'`8eűu%5?kޣ{.(`~G G mwI|&kiƣ좥]~QaIZibf' UhX8:S3۔ iӝO)7.*o0g}"-V%&KE ՏΨ\i'7dW]p9`ԗjyV{uJf,9:kwmwKU#X|\/KURԯG|~"01;wPC>kC6r,& Yk y\I֧F$ƨh[`%tCs+z7-ilwE܍&'"B?蟷Ol +k71 f_^6Q!/oS**t@uͪ3Q`x"_a=ßi(9+nh3?hH=t*"8N:^n) 7uDܻ&oVS}K ZnVbj63?>wpU:ZHJoN5;QfMnH] ?_NB)V9ޚ [P!Eւj{hTؗ?ȏGHu#]kMqɑQt'S19^nvmMQ3L9 ᇽ$'ՊA;z4Ѧ3*nYk+*E:tocYe:Q7]eG{5`&Tl;g%TLӸ)[Do@DŎ|r<ŧklz@6RaLr3H23](]2ӝ?3!Vq`X:N(?uq-T^`gG/du [~TD[BdeE=GJ]&̬g@*MJ!/佪Z1*z4#%5;&=?GPB- {!D$@SCxprZq;B qVc=l ",5c/O"6ӏ"< @<#M3Oj-' +lPy+֙fre6Lav2Ch+3kihv9,~-iZ`wS?v? oƧB%l20!"u Wy,r/%c~H&RpK0굍dɘe}Hz.:6@sI;_P,"_t7\L˧x\4Q '.yym܄ݥ(\؍ $-n0h|!w.ۘ%.7@o݂xTn$sٻxt'CM9ӆ_vػidIpG@ٯmaL>D9FKmG_Va}/~AIc چ { ߨ FqߡC %++'=,ݧ~$xS[Jߣ!0ojt^~βB 07|RN zKb~Yꁈ̾kwբË\l@R&Q$&:L 4G\u\3]:T7aIm:x/oVTwȺӊO `8+~zj;!Qg! u:xf/`F9D y qZ8/ g Kzb x{=KnWM4D@ˆb"_dF*[h!X=r!JrMZm5⥃UAdau>0z0ҝ'RUV̉װtz UsuP_xi߹` jcC!l.3qM5EԪ K-dwq›\W^JkIEZ.J7SľD.^^oeikjG홊Y`kv ]v0[YZFUcc6q"y7\BooĶucX&;s)uV,;,gROu')Hx fYiơ#0,yxlE1 &jVLY Jڀ8zj#V֨/wzs0#=kFN{W CV #L!sosc!X\YsRub(I20y̡ro1jŰ}=zs1bAQ(Y49tv:S-ɭCs[^ΤGψR1˅ọB>]XPq"ӾzQ$>2z,ၚa@5s6T;Yc#9",bɇJ&;-i)Y8煵z ?H $]WP1`ayMA&YUf8E1Cur2"jx nO מbjvՕ}颁&Q g9'v9ć`|,d> 4YC12$TʋAMިIUTzi\瑏zA9g'gy8LpkuAN|4yi!Z+ ['Y,Lv/&YDA@Ne#ZT,Ag ɀP~mwYQ"?Y* iѺK~gҮOFbK~EV9r6yI&ʊ$4!$ZFm4n@1F"/Ga6*=8&o}*!+Swh9ǝ^( ҏZ'W' K7(4̵ςsTmdֽY.t޲M-+mkTP#^=2.fY4P)xD'ɍe>m;%ަO,+Vh:;au/`mak)r^ !zXgHCRN̒lTMriοKأ2x.|Vc k]0cf`PSsh" ÖTxa0ϻI@4Nʙ u/ۣjN՛r49eS5 /c1?Yc`&0TTuX:u`WOg/~H2FE?/02- wq'Zxl~I`S S~Fcevox* Y=⥈rW%+jj/}ƜU^>t,E؝,Pn/:WsքЖN.hma3H\+Zh/ Jz &g޴\(;.هP%9j=,ijݹ2p2'_Ġl:i&wY%?#}71UQ"zӨYފ>V͂Gzc+?J=UiOɞD;1xIr+Վ5Kmu:2뿔xJKv`;0_!Qgw+=~͚/zVe{>,~jKl=r;cF'RΜns܃GBR=[Ĥ!~Ph8? 4 )?"=.w兪NǛsp`#ܡ=D{#^BQ!m~NjrVdNQ+QA4}H]E {dk8rWZ=rnnY^mtA ҕ+[4 a o6 `Y⠼iD-Y?SbVIk Y!~Ki^<_%\q&_}:o< B[#yYv-YݹBMHͲaCޣݛ2{yRٯ!wù,}dt3n1M`^R;\2K3gi1Bݰp(&+>q2c'@oR7dgS DV w$%ܿpɩGV894MC %lj]S ߉rAKc x$lWUQ_|b' k!D3Gt\ ZI&c}p;U}< S|Gw\ }Ú"rG6Hb=v~3qOSJ|(*qx*Ľ]T85#p{ y5Cq̨H/YpuM:[jh SeP5՚G%Nzx~NE$[+(~QVE&OXV!c=1x2ƺ(s\i)E ]9")|n|`2}|t[`f>H [׼T,62i$ 3ipˈn^ucF"רLZ,xqm pkZPpBcm'0&7_WG7mЬ(io>eO p=Yih\;ⵑާ#Z?݃+ۓm=M38&v'TBrvKn/2e k8O͡UcQq]ktSKVj<鞈K= ǬFgI* ls 9X~z1]M-͟{AO=ePEBAqX|t h2\dGULΖ9kZT^`k*^Tд+9mt } wY5hz_cL8f Z[4ũsfhb?' b|ׯO-BwJECU mpΔ"(a9&&inx''8`F.Q GfPi N+>G^ϯ=Q:V<`c~eʵxI͉%xl|w[*̔%)=gcݎL꜀κ/T1l[ցE݌# %kj)@3\2suKbך拯QǎP=/4Tʇe4m'hhߔkЅ;̜E@kzy2 '8[?G'/B^C,7~2,W%ƀYm% ,ȓF! V.Jڠ8P'l0Rs&_B]xpPlz]<繰&#Gi/{RYZ^569 ~!}so*K-b`){Хyү Q f0-7DY=%}vzΊefB\muQGt妚hʒFBi\j{5;unq_r4*?lڨ ݹ?aXiefg+"5KΎkV ^Aj2>~-)o5 Nz2>|╄>P_Ⱥ4ߕ$縷oq" (ׅ(BcG^e/T9 \E0T ˝7QuSIi g[)9'vEP("i m* B@#ZX,1 V4Yw$(?Xx19eѿH]ǺDs&ԁYJdN@D&]ѦV-4,v)g_nP)wq[=gh?d2xwU,(5Ay%z*=2Q:kޒZ})G !sR]--!EjQ-!,j@r-s-, TH?h2ՙqWN߶䗇 qP/DJ܄ i X7꾽'0}i!i)W*N.Q;hזQ 1{zG)ޮ  g}4Xr).\L2Ԅrj |]! icWvygY Aj=^iW p }p-Fz`HndXrՋ5mK`mfݏCUȹ[|$@_@^U3 ֟3rm"$r_ Lf/9>T@=hz_lqk",R\ W2.v,) VSBt]v|^BB fDO5"VNexoq% \JϚ19PsJSQ,aϋ=ZtWqU)ɨg$ʥͮ QHʶq4!_EOI<&qpR\li)NMH ;.Hd+t9~0ڿ&8\ LRV!(=Z<$aIgŦ7C&8,>! " AcX Qf8DA um;%TLEs&bQy-R $ d"ڒ$C>꺰Onʔn;6SR}xn`<~YEv>ƶ#R^@l`vYGD)cW0p"NC!dԏUbb;"B;а0,lkS2n-z\51W~2l^zT-'?f8;B5bgaI-e"vSgv[[[jrR#,-bKJ+fsu:"YY*K2b"2;ǐ>:ܤP!q]ngHQJf;-8E*ľy(4CJ\|VFT f+$uI-uYFMMeOԙމ0UsP*\/-ϕ!, l2[@9=\D+^gXU)`)c# psPUKאNqF}yb4?,/>I[t<=nR&ߓjb\fK?q;Cay{{kuNx]C3f)eZ%R ?mh&bBZ0LtxL uɿާuCQE*"~BEPag)JЎ2<H=LDݬC8_RdYu>۹'Kϱ}݃L?jɈz9,MT]IF[*GYyGEn Τ!ӝXcodTe֠?O3r!퉰rHBz]<c)@d+,`7R"^arERH2V'8 ;G%Tߥ9;F_sh: edp>%C;٬! F1zL}(*Dr>QGKcYPmB!R5&|lT?s9*!(G'b%B;66UG:{s5W~o:kfmQ_$}{.z=!^널lGIA455$:,b[#F",vF3S,A?G]X .\< [p|֩]Bkj W/2T0ZZ;s"v QydqS<V4["QO[ݬ9 `䩍1͙-kVX63=ǞF;sqqKyssm!؞.@F{azۊ>e m8 w՞R3J}dܳJ&/ݏ3$]ʓ,o4'M \$ip)mlb<*wJ.ڮ.۫%ߏ858vyļ7&(Op[g|ۓ<,0c.N } !2j9K{^bZl@oz|"{wOx ^8":3Jjٽy0:4k͘a 3S'\:/RG/_Q͂Ł- T;1ކw(9RlDZi:-Cc|҃R?qDO#mZi$dLr](1#CsDhz3tRc Ç#~SщR<43LP]+/+ʥWnj aR]ߝD~T+k&jASaz0.2 qެ^迉>؇(O}ET uU^!zKv69CSNfNl395>..MÒZ[cۛ[I17'|z螐O|QiF)xe봤 d4BUYԆ+Տ

꺮 rcҕJFq0(Ng6谹GC_1O6Ӣ\XůTlc 8 C]#XB EF c׻1Br] pU۝7:_>*Ź uHZ=(g.&\;WT[U:Wz`{ñw|)Y4 $?f2x{AY{[bŋɰGsedaV)RŚDSZ&/Ŷ|sxd1~udٿZc)DjaHHêx`jHN7D a4LHm+t9 _Ý!^bocz?k!B.t s/}Xr/3^aHRppQxF&=( b uވVtoO]>~s_I28Lâetd'Q_zB.̀g uN07:wӄgK zJ l;rjswHHb!qF7qQH]aיq@|㠖+u+;ࢆ2j:0]3B.ϩspvh.PA\ @'vƾF_-n#-gCk%C'#gW En2\wX!i^b3vN QaX%L/)Q`qwٺڂjt _m:!ZF9#NM5C%d ٹ06(+לd1kvc`GKB07<շJg/E?/ ۼO_ rD 4A@/Pp58VKX;D)}cṿ9,Vga>F)^*uA* IFUЮ4 "h8HRgi"nI 7t\~% p(odE]>իGt2C9 />ABQ-%ފcW,iCiu(1" /x-:q2UD%ծjM?Ύ?CTJxVvݹIA3$tCbu;h=:R@oj(AU5V!,nzFn / M"* dQF$B52p@v0[8n]Ы/6ll5޿$%,@%~*ׄ9+N _OkqdqĉcF4"L hױ@ta>Bf$4*HO8Yr_G@)5/((c~29]ފB} GRM/4t>^Bt3aO7ioiI{ wER׹Wg"&}VPŗB9Q]cڵ7͉({Ti{ጺKEՌ3ͫS|}].^' [Q_.Za+lK$m~>g $F?gILs/놅/ h $fix> O{DcnY.0ᮝZ[)善>cb%ͨX"זBԦ7Ď6Iu16]ɆيR 0(CFWp -QܷRd }FP003rS5t\槤o~§2Ȇ+W̿$%qEm* wQ;6!ց~]K}ׂw,Rg]3Iښ1-@4@澥|Q@h᪜o$Jr~t09n~p,ŒA1*-׍ ՐID!Z|}G' VMY4lb03u)FT,;ft 8)NDMU-RmU (]ޔ 2 (PpnA#j ekЦ3]pHh"eXBgiФ ^V;P i+3KK7Pi Ј&uL-y<9mYk"BK/0H/R1jZ'|-:_0R3H< 24,NAҶ7֞i<Q9X} v*(̽TۓtXk4}P4;ZӳXME/&{;Tݗ/:14VlT]Q5 +U+YW86I9q$kE[7sQE ;wȀmv~iUT\l+e7cZ5%y$GF!'B9πw{pZݴtH4nDZ#Y'GoLP8zR8(>ǟysw={8{Ժo<l* *ӢFGLK/McM _<gV$UhA~XlM A82#P5!wb_STr"<\Tөќ#ྫྷؿvPO8U>=~8*Bi&1e1OwS}Dg ];.[_j@zzuٟ2՚)X)hg`穔I637i%Wy{zgmK8@ _3˴uNo`a@ j6³9>{=yx/=N|~ z?H >odf(_$y;o TkRoo!0\ᭆ)-46GHm7L#7]jC.S`$?]Fq S^)NYje[|öϬyѩ 5^-8GS6AQ㴱1w/Z'\Oe[:E , ޔ>hF3gxLYwm#^>tv-q֕ڊeOvvyEpHax1mi%x>\;{!6({J\I SKN[`0c鎌dADf Ne&LhAvvY2֦|erg  :_)T#2e}}RJYq֦lYT+=J9iՙ gCOmwiA&@G]6*Ӈ`fMJjz/.{'Xm0*!_W Z[3!=m6 z>ݙįE9CԐ_>|.:bM@!&5ԳժJwFřҩb._}CôDU&9B7DRf%y0$ǁn!WM^SUv*?lSj85>Fnķfxs",2& IO)F}e[Lh'v$ÁWmP 9ʊ.XJ8WY/Q-mJ3_B_6T\:Gs;b69h;B*g$gaU)mJ3i x{JKv*e)5܃( bw@Λ:ܱwP*=\;2vΣZ02U&g3-_])"Ժq.45lU`ʕhEL Q%#f0A V)B,*?^Xӂe=\UKzdϷP20ȻN94Tb( =Xz(Z6@@${7(Wo2Y{ĕ.F_|נ8c&u9,$r)e2nnNl4Z+:\?40&u Lh9 [&DMsV틋e)\bDzdwA@hD> Is_q@r}Lu/ï1!zhjhY, ߀SV0 !uАILy 1[e8 Do`Tl,#4 du9j8;`ㅒJz ӏrIjqg@X P :ȑ&:XȢ5n`/3hxuD{E'Ag%„־Y3D=v@7ښ+oW3'[`<@L@2\k8MPC.R| %A6.<)F&VLޕYRC S͞$&`?rv[}OZ*X3( {Ŭ]0a[1>__l*Z56v( KZJ:=_dN^9M?#t!04HK=o.J%WftpCs\+Q끓 qr"-^O[$fU}_D>&3IPS3N ``>tsinN ](e =ސ]q#?ENXė$#VWYO0n{năʯ)'rR S\WM1.W7B-hp.fwtL#"_ P;I`nS;3^Mf,Ce[[$d6ўv ZƂ*fgB=_\I}I滘n)S|[< m|c-QISuAW9>3/dO E6@6UHJn38#-SH*VFeB )[E?pF^g֬Eɣ}$'Q>ѕ߮.YnD}%lm>JM+|7RnRzn ^%/u/\hhAF/=GK!盕6hVBccV@)X|Q g~NHgA Eo1bP-(ʬqp{#nd~2M'婇+08(B $9)xKE K9(s/Sal UNj2*f,Q(l^/cPpVb]C3By@{C)l61<$cȞgǡpaA/$cuۿi 2}(ԉ: @ڹ\8L"H鈯2sқ0NQcm7^xx3 u+ v\A1*γAS*Q ;Qw= !#4êqg(g#p!)aLLc#"toq~vPqN'>8j~(KPCgnT?}'xt'-xf*fTDդg^q#A~L!%zRoW>ʮcl}ɮ `lh蓠JfHtW_]MDw\x<pW9~+X}nXsh̸Y1_w. A,)pzhtҭ:"?JFВ2.ڡ t7ap㿫h%7([iF5x`cN|rK_GFV P޵ghי:+Hv8 >7d~r1"~S2nl VX|TcMN%f C܍]&OﰱֵZ"a$pxWʩ#Os2ZODjdD͞\lkmV ս7O4kʡO>3ƶ몷28%϶9*xt( bBS';̚(JL_l<:_AntF5Mc&f{Mޱ)(=kہ Ģ(Փ8[5/~D7f([ej59)j^wWFG[ Xa8c+mD_$ %%_2%Dz]{ Nmq>a}_n6ֻٽa #2rÚpzz\F0!?V +ȸDo ]QZ*}eкVy.g` lACJ2]y&C|hF6-dv~@;Y^|QI(Wf9"A!`htz̈́Cx2a^x60BcG/-}' pl/~wkq}ǔJ@dK:1]=0OCgv톬,O^ ͣenW(ػlJq_YHn@\7V7ep ߝT7{KR+[f]D&(+U:<|ENa]y(afY׿CBͧ"Fx2`H&<|b[uVag~~`Mz#-&R .:jՑ 2Fk%Sc“,\ѿC462`>>2n EѾv륋p#w}[dh& E@N:ϡ oq;EeUdo;SlF3V@gD$8H+p[<2xSܺKt]WIrtݹ/EXRhP?`~jmKPθ@$RCخK<5X; 1SG"ފ`Qj,MsKwFmI/-\MT+vdZvRX*&r"`VL$S{/,5hSɆݚz'B07:Y o 5SB6Jqc/MZis(. R_H5 [+I29_F>]5 y}i%gu t.%eӸs~ȹH 5:\ᔞf]|(,jt|Ud9_iѿLjVڭS#`PO/wߢ/[}HQiH#$IWji _,ofJ˛y2Cڙ8<UO;Q[j,{IlpY-w9%})AjS=W>l Z(6UmIwv*oKGsSH*yFTj]Pydl a3X{se|+Rړ6ڝ#m*a2~ìv;S熩0XL: 3[3 -)w4_; {L Z&9=eڣ"2^cf+`ɕdcSg-aٯ x2+c-PYDYm}_E2%@?koa\V<\^i13aJ?Ĝiِc@RG񩳡JX}\B0Z818/8oti utHc2'&k[aD;fgsAghOHm?x?XʼqЋbyCw3j7 X%ݡ}MFR_WFBގ,PڜaULt[r7=k Ynȹ zߟ4iWWb|y5iOpGl4~hظA) )JyHٹNbӥ_ЏEšL8Qyqq9&Y4KӘH܏4g<#S'O_dzBheF{nyH8lH^(SG#gnؖirS^7V~t𞸔p,pu}5A)+j8?h>:&"XbT^jσU(͊+Ϣv$7"jA!O\4 1(4-=fGI*UY\D<#B_wȭQ ġRqۑ Zg-0KlUYU(wͺ Wm}3F^ij߯!}pp P^'GZꨊC]e ȩ0[HWGCI,XxB;a$XN3n!!TN`owNzxL5IkƓR)yW>T(=;zO+l :Z0u cUI]֞vצsC/JaOswTo7CoC$9s>//%Z7,SlnQh &w Q"&*:)ݯ G6GhNT(IH/ )3 T!r= N] I%QijchGd\c6 9A>=Wz䧼弊x9.MP l1cGYJ"VtqUɬ ȗA[a<fԨW\2> PGdw Ů`Bz+Y:h>y  Jݠ:u⎓[#8t##'m!P$=i^}2c8M 8]sHoAejVXA%\0?\ph&4-D)cڊCu`֦&>Ύ8~`(6hN7[\̼$ё#v{rI_sq.i\C=)뾷zy~Ƚ~]% _5!>#-E8V|:Iea8WS.H^Jg9b"-Rs]\h;V=xxyʻr}jzsL1rXK+vΰge\\@R6-]Uݨƍh$~_ئj BJwJx 0<ø3u%&AVQ%6eb5JI vMZ񈞍?xFw/2Ńs&i?&IqE~Mj //!M[<kk(H5CX:Ke{itG+V6Jѩ0ϘNzȁ!@8qdo`s&KUn?XnQ<+v}5Y#&O8hwG(JԀfgOHa3>#A> NrI~'`~.%x(',nѝ߼%H5j>BZ#ćv: \I 4l%>*)0x+ 3m[-_hoUe/y y/3KF9}㡦R@.vWw\8 5*1`EO{N!u:\CZMK@8_St4[RV+MH Gd%HX6Q=27*9/-0SkAVy)/ | PuCD,ʻ?VR m{f ւ@Cmz2`DTĽ pWy)mgie)?$T׼#Zz@C_[{uX-)G7In F%-Q- vgpjsGȿ5jMZĄ+oKD-bѹ|-FM^wLD%nՉ%$wϾ>_1fMHNO; NmV\ (6paMbaW6̎fjK/~v6jLvP% >v S}%R+/}Q[_o,||1H}/7(}.x,D$8Ҡ1K|UHh$#'0m0V)-?A]VsG+H@eI3@ 9x@cТQ=(0ފϟPgP:k%{FZ߂b=ѭK.: NeL/e1̐dV0.Wm20F=dꏰQokw͠ &kSe/q䰓]'+'ϩLxzE D*!s KBGfCx+$♇Ef=@(YnTQHdX|܁Xi` ^lG@51gp Z2F  RKaX)]3_ѱ52ӣ&&ζ#Z-R;vDGi֌h|aB[oǭDƢ)y fJ{c  kyo! a釁~<ɾf&',`"v&Gp/D+GЗT%+ d%Sйː*c "!FZ"MH޻Њ<w~HUD<'@k=:<4rk{S/*dcĿw6QإT6e"=[j)hنRmݺE CN?2 _DxP7~Z~#9>U!LlȓXg%Ůh؍wZ= ^Sr΍t,bx4\ylҀwO8''@g=&+Lo\|+ =FZAS ="LoG:(P/ q^_VX?j@Tmyw4z#4WMrI*HGA4ݒU.-b+"jeB#M_kaQƬp7=l΢HզKL!VA)6, :98$q$M|I|f*0r3 %L>@n9=,Q#|my(b?hTqN$byǒWxhcț'oZ8K0<<: >N.J)g/8י+fA GR>\⪝oZ:Ĕ!qS&O(. r}Y9Na/S*\n>d.aì[k6t%pP oIeNVO pic jZ $<Do ΅#%FpK_-6"[!sQrllR"PDFG RYFR$qWo<+k<$!N~c\QBb`J _ܑ:폑RߝcyKhN۾~Jczcc#k0}N67BuL1%E+/(p8[3qQ65 Uv8ε6,Z{)>MPhmHm!eLG(8 Ԏ7Xa& euDŽS-F%h\C$gie"W,41\ T",R> TȁwͰJn,w2A&Fl,r$DMa$r#׎{NQ %GA5cW0x @d6Rwdl[TFo^yr3Dta7:ԨNbg?"X1gПvCu%rгϮ[fҴ8#+Y|~Ǻ} ›?yh4_ |,g(-?{6 aDa៿m 3LZO$ @uy',DER)ռ`f},x@,eC8Ԃ;(BvD,j7N,³Mx;ݶ%`hm4Db@b3胱Y6~0p!{*Wꅴ@7ژmWYU!P ^֥6[W]\&eWHs网?*b׏3CU$oΓ}3݁B Q\?;SļT琼.TU_ 0ssӱ׈F^ihRA{=^` !o0R͙4WUT22~z']+Òv-X̐M$Niܵw[TL[`ǽ!`am*C?]>g9ٸ}*ʿ}S6礪aʮgZt]g_XsBi,OkOrZ+׏V؋JN`n_*_/j:NmC 1Aj>S Kb̛ yWv @(HQ_X2ξ*R,=bGvHj]u~ ЍC&Dz';R 3 nA)>Ѯ~Jr$7,-p@s*h*x'*GFtԡH 8W8SӢrrHuLyKb%/?_Zxej sgLo!^Wk ~cTk;!ż蝈MI"8@n50ʔP{ϫGA'/M|xz(`ЧphKVR\[pFuoci^iҳ8hs$,46_Nw N.}e8R.ۏcfי P.zN!Vi,,Em6 Ar&q<  .qD ڬ&,V9][fOѮ΅X22y^`Čkx:?Yg1|BP[ E q._}/r^ `b{@׵/$&dʲF\+I8^R2"ߋ&(+jcwh,(q&/fݕ+&lys U :%Jlٍ*,~z (ϊZ͸w1Z^(?>,dBTF9)9 'phA#ͽLvH h^Qx#PmH8CYvdw؜ko A\~pkiox+ kf#[QWƸ-:t(,>?;M,"0N1<1HBAȉD:vb%8;Y'|cFG2y֎ El)9vd5V[^^ܽlѧ,QT_(OMhZƱ=X5v4MČ / H4{KzNv0 ._,=nIZxS.'l1H-_fU-s^k 2 ĎT(Tz`Ψ ZT7 +YDJ37ZFF|%I*פ]gTG,{/_7L59~j=>'Juz93,IKuxWlkF0De *=R>#6!|yR>5U0/c]6] }{'Ł6^R%he {YgIal9a}T~08Ǐ"Tcd$%~A#'J+@2] B놏O]-}5l$f[o{N dƒߦ_>VoTAnQ|5[+ 3͉6Qռp0VXw#R/* sXPn(|vmך+U[EH`kk=D͋ik?1B.N~G6[B6"NOM(35" QkM5(f"[{RZIKaӳ]3Iu f+%Ƌ*ґtďxK~ZQ{RxYX%UP3-I5)1!qDOQD% kB~i͇<'fqz&̥_Nqb^}MIr5w0DQ}_ #|Έ,ܦ۾y#V+DRp OnƉ쬟a'%tufzB*vODSJlse9[kFofJJL b s6 3 tNGh@'0mxw0:p W]7Yѩd)G P!DR'߰ 2Cabm{y6nh~0sL 8]W@; \eͿ}!fpOlVñU[K3tVƞ {h͗Z<ehqT],m ֡W6"%t^j"/yRds..7e,"eE 4ߓFVuo0ϴww]K=oG{! ڬყ@8FB@ֵۭyQg@;ǹA(-"?3m/.ւsUf5kpv4V௒VJ;j*wb. k~0~;*()dzFs})F7lȦ!<%(iQ3V?>qdco"`T!m+ "kw@ > X[t๚44͙!Oa MY=s o5 .x6i䦃'۷)|ywcc8o?!%'BdJE>`8Z4ガ?;ycw,ZxOGW] ثD ݲun_Y)jisYB`a{7Uz@SO]`GJ>{rI:}sd7 TzM 6snu2-5ON-: RFG%묩*bg/$ʱ&  ~Xb=j!0oSFpŷH'IJdZn0FiVJuj>4]w}jkec`t8J1S\+MW|;9>U :"3;?#+!cB3>6kGWԀيi&iǸx4"gO]&N= U"Ƭ5&;=aQZ2O$ A$$:&xcqd Q&dq< _j @CGYDvω)4/҄uo&yi%-):v1? :_h]KZ5x.?gQU4YyمOl.җ*D=a?i{(%@'yd`Z$:cpV{Ga?:O`R O`W@ ','vy^z3|r;X_*~T%û63бR~* :.jLԦljeugeݼ3&/:c$%B3 eB_4e0 kPphl *)j||< MV5%SW GYy^IO@p%1 ^xFkE5 'VI/=JǁwnY0{{_eF!$ٴʭ}K4!-$ )̐}IjZD`g=oE4 DywZqZ{E)̲t5 G0ʢJi{js -pgnv~LᥢO][xWgJ<X?ʜ4(,y4pŐ싛V9o2tT[ G 2M.DbKToIiP[# ]}fIDjOv𰣶ӧv81G}Re!IGq8.}K9٬T_&& ۬OKK"_'1䣑k9mS1 S0V`ѸT*-+NrZnĝd.ZӗV= i^x0MZc=k,} [ep+_"=<%1N'Gupdr F51>ЌS(xJ2u/TY@-0>^k*f~1T> ۑr\t:@Vtmieхx!ty-Z@LOtiI6k7c ] (+;jgUR?IxN:BDAHo+uAz^ޛ*Ϻ;pK-HBxF?J ˦OTX8 R'zb7oKXU _L mf3zWQ RE,}< q t X?##B DKF’WXw Qad92`mDL[I@a7,jZ}p'-yK~fq,әTلπ#hSnk+և)T"R'*D5H}Ac.#~xβע`]3,~îa xm"xz>qK=rP$rH|/-Sw/U1*b 8~8\QkHzK;x_fjnPѲ._勜~6Lm-% ؏=F7*5F~yx,mp6,Sͦ!Pwlއ3VJp|qɚs.pg#J <8>Jb/( 7-Gbs q9)xYuë7hk/ftTN>~1 _A y%6aHFPv2Neh&JwJFI'ipzI SPJ޸ie 7U;seCTwaB%AqL0qG&TBϔ-0l}a;»JixfIa7d_V򳃅eqCQ닯 Rxkul0;yc@!k:3|2v$%>e%dB`s/>/!QkxRG> }%YR7 N.#b0^sX3^Fg%[0{EZ-{9g_~lz~o:#4|z-V6PfcpPFu%ÞB@p}Wa8ܔ\SWД`4zٶӌn}R?Ji·ȫ7ՆY2FC J#gU C6)Aol  ̐=-LjǃQkPp:x})asYk̨u *~^’=Kδ)$+|fX;>=@+&?ѰbQDS5_C8¬>#>ZcHg 7A%*Z)3AOnOs.XDrʆqbĺ1C` 3SfJt8Y]!t)4yJOѬU|,DRܫuA{!]%nml*^8%k6dvn@>r*5r7ōqi M /!=V&xG"~Rh)j l xqZ.b(1N 4U7QoVT[]0)?v*k6͋gQqbr3>9kG"K[j4wDZ`Y-rD^B4# BIy\CR*<ҀW5Mp ^鹠9wԃs;BKa}U5YvmeHqP(&]-h$!ދK5mʥ)8նyZ$vw|`LXFQ k.l$젮 9>䠳b\Z? Adw*~n)2t;m;zCc%>X ^_kh|Pgu#N=\P+1a޾ {_P^ǡ;tlO);ԕu^?ɻ|DbjE^jYE.*K lYP&n&a{6`L9SN zZ&we^Zʤ.K[r_jO. XXK^jyӓ+>OePrjᬌ&}P7m cM3=c2YI_CZal rUS I@/ NMh*٩h~zbE!*.,c{ek_ Π]K9Z]`z7?M[Vm(N6 -(G#lUtuM- AoXɻ_gr<鲈 NVQ8ڔM4arRWڻ.y(oe; ]L IJd_a@.x8TRm+DzA1N.AL1?;$jJaʗW֍piN1p< 6}pٶK'A™GeKwce3W13l`ȏ{/]GG:h:;ъ,TUqR/nUܱW۠XN04v"[Rˉe !̸ \uԷyeV@yUܭN tΑӇ%n K-|G&wmʛcvk2Yh}9M޲;+{O;6-^p>hiRUp9 ʚ֯2 =5 J뫼OPhDI³Sf} P>")jzq g.< nᢟ|Ӥ{MXa8J_nlY9@:~?NBdKETm6@LC6MOeu SBg '`3k2y'$T8rA"q=\ې+aK Y8 -_wY=/"zxUSNmD6[=% 8D˺:+݊4zh![o!qWM VVԁZD1m!_eM!X9*zm9|]j(kSpx'TVho|Q%*̵3\'i/KXvdO*{y۳; +Ѻ{4FABI*ւzSW.r(U pxWJ"K[Ȋ 4b;u߹Y;G-OTy"VZ9*D&FSlnc`gZlT}ZC/ŖC7w\C}hV %Ľ^%Um~aZ'F,h{ؾ J QUFG[Wiܧ< [d#~8zCf#/=XfD4%Cj5nS5hկ%ș sʍY)Bю[ysDcYX vW'Tb0QVq< ać:X"ƵMM'je{u6득Ln阢˸*.b5IխfcAeÞM셓C{5ЀjSbGEqޣnj-y7r:7wjQCBy2Ǿ7pl \#}7Bρ1B8`jY e;ˤBC-٬զn>'X8 7*ic5`9pvzKB;sЍ,G{Rڂ2bN̈́\ok좿tf}L%bcY\r`>z5"g3HWt3jW0U-=Rycm;J*2wSjE: m U7W|\'Ӳ62^$hTY0`v {Sw/":> 3=[ԩqv%L~i¶eUU ů.(h m6D *NCN\ӦXi< 㘭[nHp0/"67̀u9Z= y6̒|g=ע7h3wnBnĠAxycp^WFplBW9Pn7 Ah!8/Q5Oq9izTUY+f+AU LӪLGofZpny֫ Abvb\P 9JOZF܄d\n2ڨe)fdw) "i]{2EH aFRj3q8BȆ1 +YW>ۂ%q*9>mgird$ 0L6/iUyyDqPyѥۖ%vok~6LR.N& :»:D1".( }vCa*'Noi .ܰY4 H۴kCRIG[ |Q@d_߆wmVշY<V7{\b(/=j嵰lH'fyw-ZGfU(BD.83|1`‰EW $l$0ύ8^CI]4De:-Zˤ{gʫX58kN~jOSGp5!]&*>+#9hש<\zgkU^+@ A޼Pk?KT3vJ+<=ͳ-\pc$n4 T}J!e[|CYPYdQӻV`Fb\,ϋ磼 92IRTlkbmO>*i4y v?u937/m-vt.,6d:`TKM75{P+)Igcwh.ee;M+lPXǩ 5XðaЃ CZn5;`S:W%,9i᭛eޤ5ʠ$MuNG K`5rUA/ @>e[~ ^6d~trqxEѡ8P;6Zb,ϿLCS A\]!U@ʎ^&GS΅ج05`1(d 3B(AY87jצQS. Obb%VXVWwO^%[c[@R뎗a]{ᚶ QC|m' nhI0xomܹ{:Ӻ@+-8`bTg)㣦A뚣yU=d(\ ԁj7uM4ef%ֆ&KzFꝦ;Y +g2qxlDŕ: JOçQ;XvIY)8~B>ݗV[-^:s&Yf0I핁BNAѭv4fJڷ$0䲐Nͼזۭ:J}͠Ay/n}ULioV }9 s׼0B]Xf9bf" 9⡩{T93dnKfӖ!_*. iγՔn6qXfeK @}[ep]؁)<秔+Y/ji&Wl= L [(`fp& 0NV6I}מwi YՅ. Glqv,ߊt߯0zZEڰ5^^bx_ /ٹߗuf@5><v-A1>w/C)?r:}͡K6Cxyj(ps[exƫ9O^gQ҉Nu|ǝ4z&yTakwNy[ gGxj2{*lvDJ3n۠߷K-7%{0?Ze 8öi:pۛBpN_5?得ggRn6$jYVj]I'BG\hWu`Z*, CxSS쵼%BN#Q`x {VNIק^Pj-H.-<OcI+!6OP'7>=7dtZf+^1d@1m]9W5%M>A[*YvvnIdVgQyOϖVv#9bd)/49I)Tk`w]t5h6y #ƅ&aڣV9M?%,'ߠkNJW+m3t'ճT/*{u:-6Qe*xR_wF[`i/BꑂNż KV>g8](K/ :FCػrAQxV1}dՓKlw +iY PL) ӃeDHh/V0Z|bYmRxWe(HhX#Rg@q[[uCΓf#‘c]·nB1wg rWRGZ}<ZsPЏbp(Sڄ8je{F o[V%q 0 D s浭^^t n}c61x2´ : X\N~kuy4k!KV,$Û7#h"Y$IeyS[[R8Iώl]xuFJH"duS+b(XfD%('GVOp گwp'1D KsRX:ʫZz;{9{A Cg'}VٷJ઻ZPvAMFYy`TËU@aw\XA)R=d*+io Xl 9u&)^ȋm<Wv[v V}.ӄ-yܒg?Ms0 .ZqkWHz#*? ڡpδfT4# n;lKAЄނ֢:DӧTtKZkpgʬ>_{ˡv?^0Z葀,O*0ui=5]`; PZ7ؙKH3'Nذ#8[SZ\.GmvaeN`&Q%PLo0׈k\R{{w;NdJ81(\uŹ$_>A6c+ڽ!K]bW4M5 !m}z׆URUh_uKv2ݢ0B6-#մ@ qg4iSC"yJSvZ,#QkBhֵT(t^Z E>n~椐 j;8OM'TK)4DSUؗd3.Pz@RY r!kW#e`b|YM#79+pAHݧsəE=uWOqpa) w/+Jgt47#VqD-{(jHwMD)l^~/l}ʰԈSY@NT|w;Bۋ0bnw341 Wcrư*j&z*Ŕ.i`+7ae0Ԡ): [A}grWXA j$fTJK#~ S]q+&GXuq-0d!gELaaf}}󚞒 [ydӇaX ғ#ِc!X4>ctNJu~gGAVEfv,Տal̠#k`T"767ĞFgR̬ԧ:]lBEJ^i3S3Yuвih誆U K0-(b$ Ӌn e,TLX+FK~sèW )Xeg*Ue1)!+% [e*I ^ٱz֓hj+Z )#!Ί&,˰{oV~U!T7wi岛ݽjGcVͿj|`_3H+cQCA#aX%M!D[ [n*cYx5(HXD I!"]3uFTV}tmZw}ʷ؃YZɺ NŢjǑ'C2%?mD׸`w|&a)n2x4϶.4&8\eC WyzmCQ}*E˞ыwXl4le%7@9ܣS2A%g{'|ď2ɾ@NbªEQxlURPGm6x*-LL R:̙@G=ĮErt0a?JζL/ai9di.ㅀ[;&P Cgs;^-Kj -O!i񶮖k X ƛK8ZR=šTzJUEvjw_M `ai a+ef;1DaI P5ZM84 c|( Vm,}ڨmuc.+zt$BІ5M7YBo( z}/d,3_@U+E '3XNeڎtu:Tơ$ǵۅ&>dm -iȵXbzH-jBQEtڴ B+ъr$BEx,dg"\B&$on6faY\Y-(Rx%𕍧կ`.nv0R2{[ JZZ]fhDA:Ų+>XajxT3=jܥX_85{K3jR:Y[ 1-2R.{ W"NcX3-9]`pCEL6\`ixELT`v#o]| IIg&ȁHpcIg]-OWX-Mji-u__hZ8l6pr(0PN Nc7kB _:ˢyXZcYz-ٶOzIhv6 1j*M_(YgYw«V!;Hs/'*ѭLs]|X:s߀";U@ܵ\pNASU;'6 l+ZpqLH}úº IK S628;'NZq:9>B1$3tMRt5ANE4V[,58J8JQ,8eխ׆]G"o./kbQyfymmb?Y<-;\FVj;oE%VF*$d:0}u3B.s9Y HSܽkb,rx-XB7#5Hѓf4= ~Pv a٧΢`-Sb=;Do&UҟJ `RV7souٰD0)B*>aJ-2s`V>fasjQnExXmWNVF(N%$=[uVIxB5klWQZ=MO\qm{r"U֚zjQDQeW+Ge<vx"x(Z:+7*7_&b]5TgKE˧_FWY`a <9;̬,Y]y2Nf۲ h-c%,Llz 8[-aX->:V煉%IK[/;y6tjWcLgJyl)LTIreg jS_lSl !kt)7˽:hAUWr JLcp/ FSw)~n` 8`敵{-1U4#N JeP `4.gfY6yqp:".!0eWf{"r:n 8Iͮuo"Bɿ[qUdIy׭r@r{S8 #K]ؗR(d5JX(u|,z.P =ZfQ:F ;f/p EB84`qA5+ͺ:¼Zݎ%ԁvlmۡ,Ӓ(5\ER0iI |5컼vaP?,hdvͨp a 4> G\əwտ2^k~P=&jG;VPnEAsoMISGvZWXk@e, /69U!qР@aV2Rw(y> UU:ή6C3<Σk>)0jNl;@ : 9BIz9-Ѣc I),6ČHݗkhYP9Wp%zUzTwÏ&,H9kBC;-I@0&$L`nԉW(O%Ab\G\ ӑo/jԖ_^z8EeB ڰD+]=sE^:.k5mz003*~VیrTCZYAh*1aŠg{ո>4^fA]VvJy^4BujA]o*m%3XV! ̓K:?u=Xq`Xj(87Lj_v\k n=3>"#jZ|K̔BmAJfVrC:hx/؞B ljlˎ@ojԖM M|lq$ ]vFq2vv}E&<t-'ջޡFCX߽u:bPz׽`Cv&uNrjeT&!`vю AJ]UIZ='m!i ƹBA6;rl|]h <1;JN%54c~s5OB%0%*M3w-P[$ ZT'v&IXMZ`v !2 RͲy]uMIA!H:Mnrܺu$nBŒL.HJ=5t:ֺJ"IKj\b)#i+ARi_t|R_+SX3ుB`]AI3dOC <~%nSR;&,' Y\܍@)GEmŅPTѮ/0Eέf+kcוZ\^Rd݉~; UzxT݁Ԫ#[*Py:|/ߎkgUBz~eAk5w?xӽffvUGkŶBdXDw^WIHF]}kdkb#Y|[մ;AL΋qsnVJQH@m ]\V6<Ʉ%$ 6!~Io\ᆇ@\9ع$@Hs$uG#W!T GqmC\Sqt=op$$>BHIކ I.sU$Dj31Bh@ 0g4-vq񵃜JzKcA>=P)q"dQ=WDԂtPL"l$8=XEDA|P"!*Q|(QrPM$г^b1k"ٙBaD+̠#3<( #sķa>nyllvb!Flȓf±L(SG3j!Gxn%-ŝ f`PFK3osR7:U!gaʂda Aِ!?5z !!4F"`Q’p~,Ų#BUbDebsjV@̆s3y}kOU*Ir @D;.@b?~@t}t|}kl&6BWνb1fHwl}<'l6J&VG_Aƴx^%йƎ\ < i"Ɔq^mz4= y8] ,15gKҁNDSщf/]HIܽ):b@)@@Km`s wyUo$r>m+"EVB? Xڻu\ @Fh€RW=#t]v}  F;ٹC*!dXBwPk' }Ә: =Kx}< ЭqD2 r^>;_>h-AJ `1RX{[[ϳ2 !!th$ږ׷]_G~N @>6@B:eHT>ه|o=l04{v;r8* >cup^0!=3$$NȯFG~yD-%`@ s5&e˹VS]nJPU$bJ6uMgw/ մ1"xU* 4K%g"֭w}g5Ald?)@':ݺo;C{җ*Y!:HCC +> ś`|ss{VMyy6|WX <&P\jbD&+ .G"Ϗl2%V5oEQ٥X,4C6lH6j\*P2q gr}wJO@#Tc8T ِ oL 1r DlYkU\QZ֭T/z|oE*}i7ٗ_RAg_Σ zI#?geGտG\WmFƢRAi8/[٠"9hSx9_,7gUn.NyxnLڜgHo=.FhwYOBzo£څf!fes4B ܥӲLX[4ʶVJӾ(12lsK 1 m̶)-># vՆ` \xrCz?UAV4(n}Nƶ6#-gUmˆ=|+jVrCoY8ӊx']IF0(L`e4Wo۰̊+' 9F]>ʔĮHgqhI((MJJP AJUfn@ݍw/gi2׭E^ƭ!K壁앑JW!uonE߾Q{s6vchnw:ȼ%8Uw.=_;cSʋAD `]Z'7 *VT$[(XۡE* mV_cH>8 c $B2L~}È)RN #~ݦ9H&F6uvpm{v>,滛O?N Ȓ򎅻K taus,._S)0XR% Nr_r-Mb]nmJJU&d֎ά*Ud *w#]ظ6%Ҍnj[ku2 #ypB)dS =2;c/w+RAtVivlll}rqJ W<; RAC]HI{ci : ᧒hQt!rCCS(@DAAzQ `!2~Oy_~ׯ[āJܡװjtM6Y!Y/xʋCPDL2, t~nc'n?}/705EYuh{$5K(5di]YYI0ӲBO;6t&CY'=ɠ $;hM? ѪIIϭN?K52B@H(+J`<ϋc=Bu #em$Pg! qQȈ *_?,UD3}20G2 #t:0_9w9jۻ t Oeb1 q7ؑf(LTgCסK82="Q)s:0a{&SWml OW9 u|,C;݀|!+c }mI'Z:VV/.^KQmN9@+XQvX rRNNNQs?8?x[?z~UY?fuh.NȞZ J<L0N=qGP)9hi貲Q˳yi'3M;&o%-ؤYiwнrБTJ፳~j~ϖJWT{L.1(*^m;PG-*&%tP& v<uH~N# pI 03K;:TZ4mXx|I>y[jrH!/w=`JO*-jYsūȰq`'u޲DWWΣcd/6=J~*\G'>FW߼zWƴ\%c>ߍ(ڷXG9fgq9syJ0@~r]E=AOBwa'|~ngӑ ˎ gEyUHzWZҤ5-ͱ5MLtUC萈9L[Zz|6d=Wi ݔw{-C-r-0[ģoX,WI4&gɍf6* 0BHsNpDk@K5&|j(;n&bҥ<68GO ָ˦Ń䜉[[t/2*sRFԞ6}$(<L3ftp!+DkXv>J[~9qiIEbZ20BrksG+Z& vIt!6t` N;{mK'T7k:0 }cˮIA̞ubMX_ٹu|73rP++R֓Y)Scotҫ9]A LVv9&|ak15&qpL2%wq( Pe`9,)t{w'̹#pSx2n}ecDzˏr"@iO~^! d%}MuH׃v-,lRZ&Iay']|,_X%;~Cް;`?]^Y(LzBlCvj "Q ñA Ę;"jLQg. #κnwv֚^ԘܱЗH$4Y"$D\uy0S[xDAeAаStdd'X nQyLC 3 ^\ŪF^Dc>,ks5n.[mcit,916<0) y@l\x[;ڐ`7F_zDtjOG[[lXo\@dɸ|=0'sqHv) #=]w9 h@arE ͞;D-MbN}ɮZ@"a:N3op`e[/:Kk,F]Mw'Л++ GjPo1y`jO7RmM۫]V`%xvn+~?amjIΙ@)/:S.䕝~69GrFP~D'{_H 4m5g82[Hc}M+(9;ȏ{j16 fX_*FᚚcarSPp)z8`zQ`yY{]ap.gvӥ3duiooh$iF7H\8Gw⭖Gſmtj#}~膁.R4(H#;%oy傇GLdR1I'e1ccF '/¡Uې@aF9T$XH0K(I) %.4Df=ìҺ\@ i(̓}66Y-zg":=O?01P)xۂkVlreso3hF3@} 2QGje«!Z ĀGc>}y‹0cpb/ǃSFMaJ/i,&S@6:䔨6 a'<=LoV-vƭK~1Y((#C'}r֞E@(-RIҍa(lWqPȐ&8 `݆iHVx;-[tPȭxzIL*)jpӌbdHwseyd!GPyAHNgCUN)g㕯qeebmA ֚``iV^5KyQ<0pXet#\C^=DE[3c\kV/( l!Y ۨŔ̄'lմ$Yj"4F0#z)kƲ0WnKs/k3Y&(1SCoghYUjfV\Sm>\^9u*vkkN}? Ln٤ ilfD@yeiO{9_YO@ocۇι%\Q0u!x =MSHt;<yJ& 47ZG9k񦹁;d+ƘAK>ӲpOЮK?gq k}aͫ0LyTwq( $CM9dQ#s6g]kz,U vIJjq˫9({F\|!چR=(/vzz @ͨ0 rjmP0a/tڋͨazfy A rާ6B"˯ǣo$pPŹCݳ5s[ò.ė@S7R/:y8mRbnȌcMJX빮wFܑA "$DJPS_߿ zV YE,f8 N 8IBN}_tɗɛd4YuU%$6jYT6)QK!v;VPEEdQTcdVHQEvIHY#OY[_~KCV8fYf{s+3=w f$97VBN`c{+9l/~'cLj}L;w+d?&t^ѝK,#C{.+zv.'v`Vs?[E͟´@㑁\3V,</] y߽T^?^hj=Sjg)Olu-qz5`OgibyMÓETsq}Jq2/ݤj=*|+H2vt kVFI[KMsWW:M4msnw#7ZkO?'˵jvb\U1mTܮ=xa,rӥ׽]-`[p*-76֟84k,o~.=#u l,:{gqry3Jw\?bW-y9 k~u\n3vi|[n^Sȏx7Ot8~F +iS+@ҕ5g>|VT>\ZLEyF O3)kώs}^`tXo=:ύvtܖ#<@in=@P @tI=Kd$$J B$=c$Hul H~NՒ]B$HCuT4\~Rl<_loh0"Z(Z4 @H~ܡ $(C$@!$B*I$4! I7]Ԓri'-jI$ 吪(^U6瀒Bl`M]C# $ՠ&!8(I |] @& @& &H-W/%Z@@(H,U"ҘV')2I?ƁpRt!md"0f L226乵dMs_kHee-s6TئY!Ot!A[U(YM[ܺ^ORurxn=6Ɇ2O@}X]wI: ܨpY MFs-WHo=fz24N/*B%$a'$~"H,$Z :@48Ho!LqL:vԁI$$}!9 2 ӹRM4'`'$2BvL6S ]@:! i$PpSU :\&@ CEYÜHMfI!Ӱ+0[ܨjZy־k6ޕPsQZ潶yu{\}] fdUnI2lkOJ@2_ HjLR u : 'ɵ9-sln IBMBY;cCQbMTBͩ' ntY$Yj$N:!$!@! @ dIIpZdrU&Cd PqY!IP,$5ГQ)!ղ3a|s1\U@tAd7&tFVN;d m!$]+&,PqyU!'5!7m2$?$$d2I$efgdX,N5wHt1ӫI!ttGX$49]պ~5pY@ʇO: ௭om[~[d]J$RCS}S! `$4I Ie4s^ޖ:xc>e!8yBvGlUb%@5'=$n!;fId$RpD))) IE:)300o*Ұ@;ĒHNi$B)$;Wj /B7QAta麍.Y6 I$0rMӵAޠ'! 5! &sZ:~+ 3^Cd 2C[c'uYvKr)% gdd9,T!Ӳ נ@I`X&tz"]RCHh#͢B ފp|Ci :vK0 rI8qY'!'W r9@qy$'BosYֻPzMz٩ O~\ɺv' :v:.n,0!0q!ղC:(C+㤚 q!2N*ԓBljJ숬jdDyEUBȬ"CcRtz}o ? $ o2ޝ_5ٰ찝S&bVKJ!w,'\Ij[ 듼vݍ e5Mt;*zId@Ӯ IRg=Cj$IAɠ!M+;>͎tsQYx<&I m2Bs'P9Jm&I7q $9\j=vW0sF@Y 0XD`^ ؠu|[sqӱzLyY8tT&I'.EER[Z3Q5ZK'FK`(N r+FՀڒf2JH7,t8MPM! t%209l55*s͐S͠Z ak$&NJ'˔Iy R@:)(3 5lnr9>}R`Ȓdtkw7P-Ua"TGkXC *XEA%6ILZF "Z SPc&*XfzFsyb4HZ(Q&Ao*66 &0&)}L]b|ݷמbѭ$iDI+_Ү˓(YIN:8LXb2ͦ5bTm(ԡ :IPtP8L58H(iAYm5𱠘F v˥"[tƁC&.+:%i^'lIƮI30`Tت@lPf'U\̀5`S!FβO-ց@#1'l`&1vJSn<u 2ߧUz=M\&ӭ$RmZk +Ici,ؒHjƀ-m`javRd-2$0h6ܓfE$Eb (,cQvwGó۽nU֦]s!?7+1Xj=tgg,7 '0`Y!B1aH߉cU4OVZڛΙVnUHWYUI5KX~dh빴H.^ͽJy,[Q5&o?fNɰȢi)_^^O1y:'R'I ;s'`I)23M4B $CU!a%0a <ebmaA&8)!ݾ/ `@_!) 3TMC]' I9L[Vӵ5δk܋@X# !B,jP;\@! Kp4Y&@Uk}PmnbgR,6Xih@7+ĩ:voBM/D8L D簆GSdì.ƴH_" icXI?;1^ Z[yk[& E}-eMDpw*$$'éV9+3ؘ2@R >ucDj|smlmFRcط_RvhՈF o'L"tZvpYdQ3=CEXBJpݎ*M^Nog8 lzJu7M֬AVd ,pkKt-a ful#б3P!@ $ :6:('D4:Ԑ :)d2!kWT  :Hp:5 4ov:NStL dhЛi_Ω;v09Sjٮ-9'1XY[5aAA$:7}>»'!BtQt:X9cֽs9L d츻ֆfi8H6kVh@T5a'07 ݮ]c`lh5]U A(d_Fpi] >;+WbMVcC}&taLTAHe; `Ettd'5CW/_Rڋ4lʃ 5XEf6PQŬGCpšڀtCA20aϭi0S]sRXX8|Z\gMd[7_y :!";>no7S9\AN3jb%N*AaJVGLxWcVpdiFrb3 A`0XF֍E_Zܵ5օc_O[ÛAE4y]mV5HɱE\5m_6a(Ѝx}oY~:í!6N=Km~&J+PiZeVd/ THuOaT Bqvu.ыU^+J Fi7 {MaMFtwtžg'w:!W[grh

HOfVhLc G"_}` V0$_dTjBF0 7jqFՂ 1clAtDc>L.O BB1_Ac%A 6ޢm;aڥ"~fMNFs5z-^;\&y\zzY8]10H!lNakn /f\,assg07撗-M#U-&yŵnm20]t5MzR %p@m;H.fjֱy]REw *ux5|uaYkU։6G`5ݤGNkYzͲXhM2 Cu:Ftu{_8;42340{]Oz'Mss&jbDEC%Ĥ"aJ!a).TG~!;vѧx'MBhz{Ѕ86k7U:s].C\Dʐ3#C69ѵ%is&G: .F鹼W!Cfޘ7f7v^NI@.  k̝'wC:ݝS9-ɣС'J+BgOj:p ˯ǫ䞾'Ucn9G, fm\ K9$>fQ ,!z~S[w8OJcB Q<^z꼳ù}\u}g+K7@6q.N21q% ʦ5 zɶt@ L6&+";հO~~؊JР g&0wl XT8WD(2h)[>'ȈA"V p Sɹ!\euiuwUcV~Ҹ鬲7\7>D`t@ ,p޾llı.q))Xl۱c}*X!jNExbjg\CIЦxެy+BM K"R1km<p_>$U]D-:<"Vj0?`ri/ٮUŮAagmЃr hn"ݥqH35 tC&OmQ&fdDAa6F\gZ7H#-r) e^ L^TkDWPrbTApbiCFAJ9)Qΰ5p2obM )\@2ϝSNR1]Y}zK2? {ng|N6 BmIXK} -4lB75^ڙ` Gj LcO7ʲ`s\*YІ~+yBe%>f BOrƍL9sE\Y[5d:q87wk2 *ǫ'g:nN'!8BPɍ̂t]4[[QaCq \ON.97u#0Z ôDiJ^A:}(R;@Yd|C Aq&j/{6ytn ͓m G2Os@LP܄} cȀ_L烬n~`># "gnP.` |4Lթڡxy{x߬+nU_^F"m*c=Q_sӠnk_vŪ1[8@k3@V+,ZfQ1 Ld"L]CM9yfmOu΢nL42l#o bp8LH#w+#KKTcQshũ[}G3:&N],Ra1Ƚh[@<Ϟ tl.Js)!vnnkRV 46=_qnr P9`{L *A7> X5,9 :Oڒ5q Zf㷃;%kL׿6{wCmy0vMDonA-:G5S3xË ;}3sKNTc[$ mhK]:1xuIЃ/m,5%FY+EpN''`.6bFDŽiP Rߥu~+ ԣk1B̸n ` jrŮ5: 0,i3H>gl_G*I@Vw9=0XoSy5Tem165jʱ-s变wILB"Ȼ̲z\nCQ3=BU27 {nܫĥA&v#*ؚZx)\QBihd/Tϊ3~Z@UPZ2< .lt pMmlڨ.}C}AESF5s\ [/_AEYjkQFFf,$&^anMSW±&)dY[s #yߗӭG,頂V/VhjpU*Ⱥ"&sdЍ!iS8H^UQSܘ(jɢmY=n*Qg9kҰ9j)_(Nǎ-$\LO5au-^Xl KU#aYk[v?qbc5ɼѬyte}xWӍ5}Zj(*tLgI鼐Žxk̝nl |Hc75Tb#ζhu8*cA@;(d.A*sK@E|O/#or}h<{j].йڮUIEE rQc'mu˙HwZM4Usm[TIL%+ϙ}{1d,u \єHd5JٴɀƐLgO<z'%AHXz o(O=I  9߃\$:lgS"PX %xX@ZgT4pLA%.nN w#cto<-uE͐+=>~5D0ۆ,@c*R)t:{zMUǤFΚG!rS)HoʍHNlN7<(ȸ R:r23,p0 L72˂1 k`!(py2%j:zrVB=uUfC%t3m*o!%-6}䊌X8D` 9@a :x5f@YVb9,Lxȱ0G&.AEaP! E<[.K6jk<65xHAڐ@#SV&ǎ}x WOM=jL&kF9ZW<ȎŴϨdIvjY'\SÞRPinO^^^)m-niT2ȲcnkNG*,b4V1qx{G_g9pi(/*tA ӃBFR@c IeKZ*0Hd̙LZJ`T:I 1r4&2maL94H-xá[ 7UIo/NZ1ctK@1]%v@#(rS!onc=X%d .6 x#M 2]ZѽkKɥvIdFD݅SNVK*L6T|`Da47t]d,KDWVkZ6x$n*l"k5˕k_$R an~NX*= 6/Yn8erC2$x|qL4$1 h!) bR3޻1ȸ՛ZvF^k9uHu$}A c|ωj7I^QX5 9d"vb9 4'v]."`FAw,ߥ[7="N6ثw $ rU)N3![s̠0SDz;t\YcN67s,gwNVIa嵪hd@= + 6AQ3we3ٳ$ɊL, HSIlÄ 'r(KaS# 2ؽbdi54g?i '74CY7RP&VnPTͫN:Ƽ_L0R["`QYH`GCM)\{uZ[81"&0 P!ŵ-/ y{@DLxs~1RkVm P7\슀޻a>344V\E*ijgg;-`$pw+B0slDCJHIOo:r9[_ m@vކ\ qr}`RI \ثSԴYVF<.ߺ:ĸ-%)R .LPdl,{zn8n>wQp" .d ݍ48{܉9+ Jb{&Gᗭ ,d9w;?# Zs9;gS5 #z;%* 6,1" Bq}\i^9&r\>;!+r>y`0mSN`znmE? Vʛo_Sx'@GT^!r^i*cm 𚖝\K3k9+P533-,Hwrš3L ,aVAWF zz]8v.N\:bLi=u6(MN=$[NDQckQb r Hx!n,B(n.3g5U-jU r7>8!䯪ZVm\eu;1N@٥ 5-~I֖zx%ǎ4ɨ E@`IY"2H% io[üo:M':f::[&tlEeotӎʘZ"0V۬*BU#:^d2؜՚T^~gL`DC+'{J 1dCYRBUid]<շdgaMi}<v]7Q8Nk|Ëq[X6_Wcw⧚vO?˞m8Yk]$@_Fws?od7]uަM!Yg c[Yd~?G7}`t Ig8,&(o q=;jrpYL'ߺ^IݛN3?ݤ'͛j4|>GNd ovݵ8>'Ku4;gsu?GtqNt.Q}O+͎N&^GÝKFq(K:םIMcu Ýqh'm~wlˎW:2z5$A`vYMbuӡϝGz%])G &JLr33e0 At, OM{GE~N2z*cvH@;d "i2ژbР%UjӎG7];u.f]7'vww]N9ۢ\www" ۫:SC2cf\\Qwuٹ8v]ΝvΧ\wiwet\ۤqEwݛ7u'Ks]ˮw ܎.wG7:wsguFB; ۍs;gu;wNL&㻆-tvQ];.]w;Db]s]uۻwn\ uݝw4]s\D.㮺]뻹ug;s.;qu8r:7]+LFMùqκ9N]:GbH~HIMYP4HI X4d!@ dH#)%́=R2+!:/d)2BBHCQP<*0 fB0 3o^@>1a$!!N񄜄a!2Q$,w+u р$ da !'2@vLתg1%)$R~zB]J2k[uwhC!9 NԒ*c,+Ag'3]?},@ .s!Y! )!Zw?RBH~9 3"?@$vHCN $.H,8o@ ,S VCA!!dBv, H3TKw_R< nHF%&T JHD@[ͫLJkmF`!]l^JmmUH9jBB@'!!$' '`@&|jM*r5,Y@$I C@I!$:ߕXqN0V2WIEYQmm$ a N{$yd&`lxU}k[Emx%@;{PI?:OC5:Yxa2@HPMm8LPml!d)I&T @!wY Y I2N$%&SF9!JgeM-fipy؉p ZAQR*X)4`CI4-Id]KWb lZ"ư%B7$ua$L̀I gBڤΒ|T&BfIWJ)8 v?۰ B@ @:DZ1d@ w@INѐatk *A@PEڽJga8k;-[%8G.-vIqR4J6.("!USU;3NIf!8*!P&d񞩈. +2ምnI2I ̛LM ;̆s5 933 5A3a0q'a* 74#PjI˰H&Ĥeنi6QhX$TF3cI2a)"D)f $%I;k4 %3ILld$a4P0 E$kb) lDc)RDVPi1M,,(0hDj*I6C R(f6KfE-$̴QM),IM M"2HAر"Q4dR4QF*P@f61łAWqs,Ѵ\6Үay \ay,@Z\խ!HLDd2lP:DR  ($&!f S Nvj`"RfrԬ#0eSvR" *oRI$vH}C$I &@B4B&7B!a$Q5RڹʰL1XL!4"$!̬κTy46M0&] dfHR5-2ԚR(*`ݢEb,6;*56x !O$ '䵗vo욬 eUhI?2A$CIhY(Jy169ST rHV,RmjiyDe0@8aRp$Id&LMڇH$ `$!'dj3Uj'CB:I&,bb3M4!&(R(4)$$ Bm>4Ҍ13fRR$FF$$iQcFb2D Q`$B,E( QtԒ$1"0HbK+ݭTmS0j T6m̤fɢ6PITf" %hD@$D(%C2IJ#)FI2d!%0 % گU5~s_.ҜNFt퐿ν­cPb /*QwƔ"#|@)oYIbIvBy:J `r/kх«MC~Anv@޵VHovl a:d*vMIW|n\ICI DŪ$!4XMII')gbti ٣~LJ HwZ5فJ\YE iڡ%$]AR!%0Ln4MT4 Z hd͠&Iw/:);9TbfҚmj!+ݧ++T ,5׈kWB}J6[kǽ.Lfo\U %@!A/bР'ZξS< dG`=[R%l'{4 +qU%87 ʙ-zͨQtjyQ'uad)AIdgd$ ($@ߕ(k-Ud o(JJ6U$N儓M63^c"Dfw>"!xF4#3ad#3%/1(JL6\-2Q^bP+j`#`a(o." v[3/6b1wwҲ$>6d?wIxMt e;uD.oO#1k|Cc@?Nxm@$fvN$ BOX;a Ѧj C,B(ʷޘh$^0HRbhtp.31o o00,K0f0Ieb#LhB(J FL׃@E"o"IjKLvCBꋅe6F,[^) ޱ$&uUQ:THHB$-D"L\mk60/a$DXeqv=« `YG v@?e㑞b@_|d͓qcpy,h&UfI͈Aj2,݂dE)-EZIT\LV.EXT[lm2!BɂU`:@UmT Da:l5AQND S*b˴ȵ 4&2)UX͂hjY e@"͡B!UVc`l`fi#ghFIEEQAn(gr!4\0B m$(BN `L`%QۡfCÇJY=me&FLÌ*m@+7&)'Ѥ2 fd6cQ6YIb0DVݦj6^ߋ_sLt5=w[0M+bXUp̆/fw,ȢHlFzTB@>{)&t=ZiTh 6*խrIu C;Pq492A y@aST&)9(Ƴb?˲2FltX}!ob,ŵ+ o‚MCA$GT(m:^wc)aOM,ܤ0@&}6Wi n9wS`n9:(C8=R(MԔ,BRI`dd Aau> "n fF F.sY"Alq R pZ EAAU6C!(2\ vٸ9SĖnEUH6]ɵAM0P`|F4' E b`2i-Զ7)YXL H&WKN߽"-VVō*^V(`I, H̓`@<~WQsP0a8)gˠ0{/ľ[cͷf&1 };.sWdxvU] D}J5kZɳj;,Օ1‰ϛk@#z&ÙI,)5̑"SS&SHv*Ϊ62( J["N1CcP3_Q MT^Ҽ Sz]Z&iFSjLQGJF\k׽2y\miU*53Гs[K@O pmR\{dڥAٶTlլٲ@%?H`؉]2d㷇'6ݤ=E$!4>֡ RvnL̄*,^.pt2ɖ/?y,b:gavMvUqIIc37BM{ L8yQNZ\xlRcU&[g=;β6^(%D"AijBM̹,Z&X@Z"xUʼ,$iT*۲ф22C!3 ٷ65u+iֿ_m$kZk%$ S20 BAasjd{חw׫z['$APf2"D v8mj \UըdȍlGDd.It:M͢t:c #e&md LKs$Kf $Q l(d f% Pʔ% 4mUk&d$ RРa/V\lCEI)tM, &B $Ie@X]*]^rm^m^s{V61db ImI.adWk*[m7ۚZ"A!3 Ob@zun:8(LALљDAI*},J JPJB%B@BfᩙֿBITTfe1 DCҌÓ E") $M%ʄETHي( FiZ`!fa  "&L((X0mB. !Hj3pPʀ) -2(gXkԉ&s!PD!&L OPB)8(J"R$Jm*\A 50n5I `7`,9a{Ln/B&jh!\CdҔX72?ۄ.C2@ v$-1aA%蘬ZŨ&&kW!4VV9ElI%$G+hbPŃds}]oM_Wr^ֈM,a1i"L h(XIITFI6iش//]]D&XHh"E4wi^\2LeIB-f"UkHDA !!%-&E6tę B *r)K7n@GBNĆ0I 08L%6Bmڠg@ޯi/jޚ]}sJc#ZF\-Oɻ)"6&1QWKiu\(Y,Bk&б%b4K4RQIjMA$a!Ed%DE&1FE[Aon-55AET R ]YR N6S7bhap͗5ĻBvKZ $P^Ϣ-2Ţg`v S[ MdYC(,Uֲ彊ܓ )QI@ DJl{in Ɍ P N M*QQn -8B`HChK.ȴUX*Y1W*b;oM f;W*.D'jdI$A6Rћ$hHF"7Rlf)$0sBҌ]kI99k0Rgzh0$0gYfITP6N+t+P'=3 '~[ÎOm Sq,3WcrřͮЧ.Ak 9qi`I R몼TnIEBEa쥓 7Oi_ښ a4 3CU#`uVV6]æ̯k$ALL&PK0PRTO}o+M|rC(m_J|/5IsnIwס𯇦|=WL .̜LS`pRXI4M&P 2Q&f(щQ]vfjX[t֋s0R,*#3%)*,}$Y Ҥ1E(3bJ*a1I!hη ,RhĆ լAFJސ7{i^hjPü.B,0=GiPM!p(&4a rd d-$9"I˃*I )@d#ϊS 2hWzx޼'.Ep5&$(K) Llĥ-dxzW]z;/22`TB (DN ,H1ƀL KƬdݚep LZj$A0LjfA&,H$` Bɴh*B zV3_/A 6bHj +5 &r8 zmh2yĊrc#bj 'V%G.EiidPdwgnfYuL4pt?$M|/{ MQ(‚RӦI!!A2`+)-]E vG7aSbN?uEV&) !vIHb̈́j0 M CgN ӳ{Y.8ނIdAHB)&Q% f!J(a$HUj"˷d© l Y#d(2Q&)mٽ\|wojrϏD;٣[fdD6PFM-3j )U07 ^XYi CY`GA@l*$f 6YR0n4ˋt۹j`gt('36tLRMD$M 6JX 0DLbPELL(D4fmei J5Rd HQU R t$`40ZR2E`(e %`[ )QpKQb%Js20NY(`‹YEJח^1 ur!EJAma)Q%ɂG}F^k+rsW A2! (V!@`t`iIYe! !.O1#"NUG 3kKd^[V ^r,< goZlXmZxI7P9-h}S$ Ny)g%mQRQL xZQ0M2K 4-ace  j ^jVŶ$XPTo[-/UFQ\m tpyƽ1gæzFk,rT˒ŕ TAJAJ$42APRd@LZ] bFgF JY S U$ܣF!R $P1,"."IT# -2l*7rb|wrxW'W=;QIB6P Փ fjC1f d"oY * *))BNW~zM ɱ{it*J UmI$]Cs}G޸ةE:5LNjX \L*Ws$w:2REY$TEd@ ԰F]dRKe)L@J|\%b6pHKT$fY/E_)0AV֪1͉ EL$Б0Ł1b!KU+`]T9ZE"ldI !"0ii#+X$X,Dl3,IQ@YtД H HPS "!4KƌMaD20F نŚ- m0SSRԀ7uo&M.^#`B%bvqQ5A`.bKqfJ`QD7AJi"˲D@ ¨/r&L\wq=z Qb)(sb,DAERP[fZ E11lH"eb,Dd+d"LBD6%.f]ٔZzֻy؊}oOkׂww`%﷋qa% ) ĔE 5 Y,Ȳ0Il( d*q Zt0.b٬j)tŗA0*Tb,b$R*P8my'$M DQɈI34.fL3<\s*XRB\rbH)aRcLYt%VMHm~MkÚm[!t(I IHoBI'-d53UebTpo{j2Y,:CV a d"ot5-0@l* &"M' $X%(%F6ʷb1[%L1h0BDB$Hځ&L0`SAPjSDI ē&pQ`2FPI),3HB$YaR.XE0))ɡzadƊ2@7A!|(n$[ԅ QJd6)1=1`Je!b;m M ,6 ALt51kV$p(68([x<ίW?>u?ۏ~NJq955$5P)7a'磀0*D*R. tMwr]:]ۧ9>;;#NɻqEn:2'.uY78ws:$n;6))Ӄ8닺wwgHu˦]stu\wr˗wNꄮsg:sN뛆@Nwvwnyr:;t'\;h\\\nN.w'n;\x"yݻ4'Pn\rܸ\v N;wwwnwtع](Hwwnq8B]2;+5vҒu\]prNN;".rw& Kct wt991G `5Dܲ@0arL܏ǸB%|?;v>emc\CSO'Ɠ:&zߒFe6?xA) Ȋicgxkөgjc8Mpy{揹Hi Q&8oc/tPor<-翣zD= |}Ʒb_! Ez n;m vK sS!kzJӸ|\!~|U)QWW.[xuV+A>=oh^X0gb6m_O4`/:3۬4"1GM g6$cy6|e}rDlݿ>`CiD6z,&!f3O8x?2}m&J1 ĆgcLT[D "XHxD[S~?P{#S:|㡞#t@Bz1=ݶ2C˄6tk9-OlŇ*iF| i| %KɘHhAU^O/DmzL7]Ǭ`{>I>/d9kռ:e\0lZq ^'}܅Ƿ?i^$sN93O&pT6wl2 4o}Y=D[tq8 ԁ6 ^ǎ_m?hJ+@p226 7O0z6.R|ΆZ_dY'eRVyH?)X9;-ISj۳qt/t17|ADl?+Յ!d:ӏg.*|4y_4w ~id{~{+^7a1m;K=9j6pp~v!|l4d,3'z?|sό\ }Ϊ[U@ {ںMy~k֥ *M E%?6]mNy-/e]SILY/0P`̠}3 ;0yXd%[tW* ag2 Pp 9+7sy B Mw 65;V hR;,Sh rlBt~W5%zZsn})re`& hVͯr~g? Of6ji0Bn0$kæΐDld3:^VE}l ݐ:l&*=f\,p 6?4[DF17vU+O8W6TRPҵNm问s\#KtXK>Cpliɋ]K:Pfp8v@\PlK>3mS " O>EC;n%k"2ɏj>ƖUrejg3ȤZ<CV`}r2DFi7CD"cjr^OXONr& ϺcVT+Y{Oݹ"H"ye\_}j˘$)nїgkHAa?Oqk oͱ,oe3}b6,<01'j/JLEOTЩ&"pq]h*%(@0 n5dC8[M@B)+:WDՉaLAޜ^"iY=_BTP`av6W/iGj^T\ ԫ]G̝m:I L};-ծ杽)ܞ? ӌS2I/"W`5b?6r:L\"xJlHXI tTT&S=c݁HS M img#i m<tؠ.ҭn"&{_zj6@{7QqyjX1_&^m]:i/M3aȰzO&+9WǸtFWDtOQ(ze<cJ["% ɮAVDmo_>>o*g*}Ncs*\{VhzYV^5֐1 6i)DB$bNoTK3>G2oϒj Z]79]iPQgBUYP*›eXڡ2-:U;<65?w#cQ=@ A8,O 4bJ!T-_tB5jszN~{VdDrJ [XBB$;QE-b>`|S6e>7[:\AF0>k%Wn6k0%Az#YPi2̮a1y|f5l1E휆2j]GVXc, xOM AuTnfw~w n44Kp)I߿Cܪ X|(t%m\˱뉉.C_N1 oVב,ɘۨvj)20HXTYL P#M7t%Kk_uu~|r-ieYMCțYKWjln6%zѵfsظ!oI%ĺy?U&!0 (B?(_yh'Ku1*G?oF : ˪d4z śoYrＷJ/ HA^??3_mOoKx[WQX)[kAEo/:=Xrnet)$aI)RkDiow; $i&FRLRɫH o!xm{w}:0 & *Hk!_{o_󰓌\Ͼ:Kfa7qhAc"d7gsLq{vÆŸnY33^w/Q3=f[keL &Ns&Cdd'8(z֌)]BS~#cbp7(r`F4 *^ !oڋ3uvJ*-0!cd~hqz)k˰҉V7K^ጵǶE %ah x?,ԱdUos_'/"G)?W?F}LȀJVl f.vGkj ӿ[Y\_ת&O>߸Pی71*DxQu CpW{~ZYCSF5V @C(3~]-dR^I"@0sogy[!* 3FkkWHԠn3 JM؊⛈ԥ ]eVIWw>H  ~ha2 4&)+sѣo)(6Fъ(0 c:T,2@sRhd2(z#..2> (x6ixE&n) H- *6p՛R6 :uf#V=b%p;Gb&` ehhAP-0o&}kj %AuJV4LJp=+@x$FDw@)t/so>}SＸVaﹾ|i[k{ pnUϑ:kOB3m[}ڵ%#/y=k]sW< ҇zZnBǂxlb8]V4Cn&uօ^7wɼplR?v?=KZ(#f+u)Tety[ >5mnzYZIWKOv`snǩ8_*qm鋍y+A[svF.EG~٥^7fo)$tȱsz4soo:Y_R[g">`xF)HY(1`@DӀWY{a*ğx*L12:(w ѢY ҿ5DQ`(3ª$B,34r?@&3߁xf:֋-삃) 'ȧ|1oѵ n7OYlI oH \2w5Af}Z{I OVD^  (!r6ϲ9?Kx3;j3Qm~M؈1ȌzIoL-u =ݽ+f~ G{\/Q{:+fk}=n1_9əԂ=?ɬ-V;D^]sҴ-26+c/t*IYT/=O-ū^ensｩJҰfW}~H:&CBBI'{ @I |`JH{f 6IK!!!?$H$|ВX!}N7W㏲BI` Hʵ uơ;Hu̐m!$?ɑ HBý|ѱ ?&oTu uH&FI$m2H@:G+$B22Bx ̐ d?y]$=H/RY$2C H0a@ :IH$XH,dm N'VdHEp=]I @d$t o`0 $ C6&M  N) pt'cu$CoPI={ k2|pY<$'\a FI0!0?-qhXMg1_7>leO{sC„oڿgU:0 UMm|^3c UwtaQ/I{?/wD3-%cw r;b5(ap1q ED+,_V/n7kU@g 6Xؾ޽v P5# hM^vp/5;#MMsӴ']'͡Ac r]S_G>9?=l;{3?Hݩy޳b Ysr63+ >K 91]t\fGJN"ցâu3k2t&Qz.7Q23֓=j~(gPKTBU!| ӎAŧh TmNj-9 cKt!t19? 'q⵺ccQN4H~c GV!a>F̥%n&0o(`T"Nn-2ߚR|*Ke[-# _KN3X;(m߽ëRCOkܮ4}9TLA)8Ti[Py07t9]x(̰,w`0.1zP6bmmU^srUXy69>b+,QEDKJpqqrߋÄ9ׁ' * >6vfm'X3K:5K9h_/x(,\ %-HL5CŻ1gpVtUΒ̈́T9wٗZ9$C%0l!%%3kf"MXa՜ƎPB#FNAo}L_7tw?yh'1=hK'r|0@ѡw!vb>0[KC{׸Gh!Ⱛ_mo37jS5x f*$=RU^m/9q"оkk_N_.-8:BsCG;W5U铑G );ݿ1pjDNՇJU+^,1DD$dKg0?ogaqdb[ܺ}q [n9( Up|0 $Dr%z8+Y$`$* VY@|n0CnACHGgG!_ {z 'fV@60C2Uh'_|klܷ>>.rFѼP$~NobcL` +C IAY.2;:}nĚb^J%(,(cշkPˑRՁopn lIbZS1DD}hy&m2HL$I~d>+ Id?P$Ccãۦ'^I!,$H@'9P]I!)O`) =^rֿ|}-da(B@ t נHlI߽!HI&tD @E?`'@@Sa$ ! $B"$? qVLPO~| B@,C!7!I!tjڤC!;&CYd NRdRrI)BuLOI'i:ԄL̾Xu!`RB$4N mFL;FCYP̓Ő$SpaP=xAVXhؖ8<^/z!Ĥ Syζu#..=/π |~MOfҽq$Kb@dkbwFƔ'tqD>Pdgvv-z{Q7vX 5 4j͡0qؑT3%9=8X5+NzJ 3CͳF!ޅ@B1" f-2So0\UF$nAH&As퇐+2B>@N\ .`a2I+݄ӫ"78PlnN .#?eenM*˘ݐA8B/K-퐹[!TژĭPl;ڧp7PkYF3m۵}c)#6Ͱ͸nт(j;>7q9""3 +F DyW6L; H}a~f AR7(S5]DCJ>9Nu5E#l 7QZ{j|2jud:q/ Ʌ*{zBP?)>o[qG4%wU _}ۥRܕˎ@0oi|7m~5@Wʫ}k[VBfY=:@ 1 @j]-,:X|΀7R.w N!|" :Q/0tƬ1?eϳH=8On1?AxgcוЂB#T=ksbO&Zayڍ7t!h{'ym5[ bRbw%XpT+dp5\M\bdL'Jp|_wVǓ _L:( I5L!+|COx\T Y> pf ,ޮ ^*/ZzٟBcok*. ވwh*ɍ<vyD2 !&A}OY 8WE7m-,?,"q "3VEg c}uImMN3) սֆv͐[llP@YB 9kߪݘai4q"0QkBv_P @AjLo_ ?~__YI@>ó$>z w  43&!dRdH|~0Ih0tYvI!'fw< â$i|gBP$@;dI &hd=Uo {y|$Bv`5F޲ABH3 f& \:WF!AJBtԙv zK#!Uf$!|t=vHg3Zlszq> xHd>kKI>,R A @w hXzͻD&`NXKNhxG8?U!kEtGnQ'v$Xd6)gӟx} ՋU%( oE]7ZTᖁuATY._MvrEgcl0_>IJىRkA z)>+%I {QQy*&MܞM$.;yڃӠ/zлD <H#/kDDxmIrqfmL$꿯$(I ,fh_J c@KiBB¹ jJQTx?`FJ S-/7}V,`)N d"!̕ZwvI:w60&_*dF@Ҡ/B5nkGclL3 "y+%WֆRߵ,6XMhq)^Ou٠m|8-Z#nt HLjqHۘwph+y"KoD!{ﷰg<=.7Sa& U߿Fg:}^6=XI Zq' +>_-h6'o蓖6ɰr5_*c?І]m+{I8עCOj (P @./qs'eTkW e N)f qovN6A *5! \_ 7'V`Wc^D;!Z;F "1O߄=P·Œ?Ůj} _4\׽tK')ەW{l52OG>]C"[ t> >=S}\_;?ny*b%,{E1 }#QpxHV#h$jD^TWޮ$*M6ZI8 Qy]+nYڻ̿mt+6v1} spsx1<=,p'i7t:L խ/mƌ<"[ sId[&IǨ#.e8Qm-H\pπ2mV>4vu) U"X,wcf]|yf@w?ȿjq4&kN :tbᔆBn؜!&>:u-Б8AàR )NE. 4ێ#>v1NRݟ{ҡfolg;/Y벢VfBm]\-l5H`჏8Mq% :K04;Շ)e)DC{?.$F.G3GDFkqr=0Y ;:Kױ?(|Pb |LJbd2i$MP~Tj Q&i"/lD>Fy٢P1;ѽEn9z>cGSЄ*RMӜl_>ٲbS#&m{|Ql;-\rOe7 |d6{J 8k<У> kT0N$ɯssG豶=z0@f[ZI~7sb$?Ȁ|FI HObjY;I̒HY$ P  $ =!$a5^3ڠ~WTOh$"d }iSR?{TR~ݴu._HU㞓9?7QJ -]I{[wj!5 JQ']+,X.a6me<`G +Jwe8^7WKw249{Z(*%wǙk%ĦXXAd~6#{W%)#逅e1c ^n7G>]՚ %ڮz晝~D/6ISq=aY?]9 Z~lȺ0vk>mAVOݢ uNOQ:  wYhf/z=m5{eT<=F(Q} }}с0vŷ\G=uln{Ҟh6 d;<GõWPcR_G!VPIeWy7k~]+wL#iv *$|b`/pcZ :?:CuVrcUc̿),5뎖rDwp8ڄ/c5.~0$ìp0v5۱gѼ[Pw.R=';?]*`M^4ѻ̯O| u}Go ķ Qw;l*䜓 09s`gSw=avZ\,NixSrpkump[n"/le">#4[rES_1L h짲'u-$;$ަv^p3 sऋ#Q`INvpweI{[QI5iLmsihl$#@>OHC$I$k1HegCA^ i[_(M5P-sjg'V8[ jL_y.V7Mo0T+zU\n?o,Q/GrdZǿ[ ) ed536\20@;Vk zDd $ɨ0Bȿ0bK! ~j>͒` I ! M{X$2d dI&]€) }[=SHL$PK<;6Cnjb0 :3 j0 }Nh[UE[VεRᕰĽť oeO1?j0T-.r[C'i:^$7yCPxVWb#:6Xឞ#]Fj &>2Ôe>_8`՘@dVH<ϚLuĐKm8 zfMYT6ee`qw;=yVרӓ}&_]{RhP(bo"Ӊ/_摒Nj}0&:Sݪ`s7$x}wZpmLCbg|=#F^[))tŊ6 i`A@Y6l'S7=%vxuY@vdNۮm5R'ӗrvCG96P8)}%|c ='ZC`A߃q+4f{9Z>2|P7<BK'wXZhq ^ܡo3I@qZ{trÍ fs똞JvFs35M&FZHN/€,1Zmiׄ Jb騵Oʶko$_5f†ٕUZ0Bbu̕+fPK‡FhhTԡfTN݌Wj@Tه;*ΐZ* 8{~Q$]aIF0N͖ML71۞z~ԥ3{9mpG ev+TBZ[ay[F[hΧnGZNd;^ǁwXdp5lSBc Oz?4%-Z 1J ]dl~J5h߹ʒQ@,n'{'qgrW/xTYm>0NllZv%$uK+ǵAeI`Z"kuO߱?,Ϫx2ei5~q>{'@Pr:=Di@+$P%kOCnutuk`DL"}5=DYB 7&!dϔo`TkD+iI/%: * !TK~].AreTjk ·V[yYbI9EG }&DypUMVͧ |xɕ(sCv]ti~VxT*0lsYBuOf4֘+(9,3ik ]#d./K~+֞sqdG H ]VTp k^ [S Ͷ!IYB~h%n|IHy7 '*m4ۋ i/^i_8[sO}|*SeGp' E BIP#u }$-C[j+} Ӕw;xl "KG]SNֿ;Rԛo6޴;lf4kZNv:OU\lYlv T?WC7י NTdkujpU䅷10&m, X},҈|dC Yy"_iwE:l {ڌ^_C@RJi;4蟂 Yp f!YVX?K^yLdV|ر[(OXAl||Uɫ%__z&fS< , ><'Z>ۄDO_ͼD[yRTZGFkm.:Åfzm C5_!. tIM^;%k:K~n;f tí7r5kedt\Jhb1{m#7Du d 2dS~ۓjPfcԐH뼒(DkVñF(hj!!f6il\|Ra1rID0QxTsMg%.TwD !j>\jX힕NEiHN /B&'|B Q=&FJD,^^užW-dĎKfhBդD#!8ݔS0lFgNP_^~z+>Rqm~/}4Mh5cy؛v$Q%.1B0A4>ZσW̙ =@^eHk앋39NhBr K Ns]{':F)_6gkxE}1-\m' dĈ[ b%I-]d%}A=~ -{u-$K{tߐJ>}}*N}jgNojW֦"+L晐m қ?px{3ZG޻Iˌ=t:;F1u^tB{ >sκP|JȖ&,YBk c lc hŜ`q_~w,QHGї-Rm {HzH`-ljF(Hgkd>; 8sK%eR~bɄ5D.CGCIYvN%(ΡXĪp-v|oZ͛V[\FZEڈ2p$XnTd C4IphmĶyfn&)뚼zkD,ʡ{mr^ʒ:㮍olgvyu6FADQ`6ڮ B1;%O6$u}_c|t72 : aC`AL@ DEޛUa[ԼwVڹMؽן_KMӃ=n2^;JR}KD=\ȶtHmzlS*B-:20w'ݐgynR+:_Vw᧸s# ,tL( M~[fی|vPqCO&_ܧJw5jmŻHukfkŖZߒ]uQ1u/ 1[>KHETTkKYsFVSIX+\Kc11?/z UM~rҺ 7Jjj:2w>c2Q^q꿣J{e IaeD U}ՈhL?c_Uԟh'kj  \pz6xs_5 :vr_}֔Qid㪉b~0~npWf=_Ȁr*gmdbl8JɴJf5ZXzze9 orc¿o/~Tǧ5\{sxV4c"ERQ؁DT =  $CK3M tqXhD&OqiB$Hl@LO~C2BRBBS I !I$O,{ZE5kmr! O@~Qz$&Y$M$!3 E t$ld$ tcYj~cgFq`#]_3!^0f~5}\7;Mؿ=x: CsD9ym ^'y{48= #Wi6fG񿄊AZKw DcH|ʽnϵzd?m3H bOTT2t֭ۀ閵vKoRFkʒi !^4`ӨUmN̬k;{YZ}8eé޼ yC#Tvul jFq^SdXBuy~-MVSXYR4[ Agi_6`2 tSeZw_'M@nG~^$QMUIvkb:Wѫ|sms>Ez[V_jH'Ӽ/x|aiP!Lt54b#Z>m`ȓ , DoG?}(U t>eRM%؂B4++ 2}nق v>}/X́7a`I(LU!'-SE(iV h?F`D6$_T|%D(E+ϱjk{(V~1o`_}\9sbM Z'A[ biy`M nǶj jn0R!r!sߗA:(N J$$0 ڐB 0Aa!8l%0'd*H@$ $@$c<<*{j0P'ϢH~[12! oMDC`Ła>/t{.gW:u}`}"C_") oB5XNoʪN y-L YB"]r+bH__̝ꫦ~)7~."k3mpSWzרD(7Ɏ+-  vI79@ޚ'@sZX] )nF\%Jte˦j8آΤ\&܃6:esI]ʑڧ֡4 zWG'&jC[j̦#rA_mtkhtVldJE (U1$q A M_/7ɟu{zu7t&Got]}ˍ*ǎSk1snv~^ƣs!8'QPYzRlkDI/ک7916 ~xx;S8ۍ]۩1шF8@EMh|j'HR]} C%޽ 7fx3桠]j}:O.N͓CgHc!L A$a$,L'm%-_Wx[ߤߡ d@'䰐2e(!8(s}޾D^d9XϽղ ~MTpp))N~@ u갇6n'^Q/~>v.G'{P;:o5|a."Fy.W0 X"3pt>+08^ZY)e>ǧ8~ǟH IBD0Ga`0x%鳜?|?pG.mmyg~22 R{ qp5PmHe 8>N7/cu#Y ~CI~:g  W80+CU?ً϶wך\W80/FDE8Aj6[l3cWȓS-~e:/ |Bկ,|t7<7GSĿJNHAG="HR/ zUr |n@?iάhu:]<>a-b?(ħ$ TBH)@cl_ ɯU$~.욾 ףPwL^E%!(l 2}g}T7&>dE洅 @Q؂!(BDSRtlл)'j=$^@EO?_}P~-v'ny%I$Y!nԾz}+/8`c|>]dƙ_7S+={=+K ?K-G!pq~Oɟ'桝>)yQcou[tE1 |g9_m ʱ#cWeyO`P$QJL*jJgr0T)Xx߸2#Eΰci.7mD!8{8TOGURsn) މHJ{rWb,)ߥ"QQu+a%iQ\~KZA'zV#")_*:yu=-C>^'Aj">?wDVZf}].ɕrd&vsMV:PqtD7uǔZ1z+rp{_ڲ q@ְ_A:))QRG5\xBy;\]H<9L?T &D2Nn;/^hNrkxq Fc, RoprAR~ Q -Jm( 0|j b͟|[(N!C桑RH&[DVVct26FO2?5Wշ#9[r ~O܄Wfy&g//,^3Lݙ(ST[cmj||B  I k}!qzzz'cT=!zǻk4zƕ~}d{fi$) ,$'H$! }BՠܠjGRrЋldAQ u9= z2lAApJzځ~},n1gz1Z"7;Um:ptUM4|/=KABsYZ:|_$B t2$#/Lj?_O밠/uϔqꁫU~>4~y?}$;!=)f \EqBgp9z ox7;7a\ޑ*Ǘ]7с8KVP7|U'-բ[G\K|i8%Z@b,n6kg7GEYxkKИ¨It/*)!$e l5XwU^go^_ 8Yw#&w7¤@gmk7U#Ggbvt,Ҋxٝ>|⎖jҼGA+i}WߤgXC?Lܛr wd>a_w@Uw(f>~ 5 ޠ2HZ‡~iy)A2Nm~+,yPO8ĊVBƥ]]b0 z ;ZZzedPӦOT!6vmta!T)N$BJ`)?b$ I!,RHOd V4 H6 %4$!e`9POuBi~ b!NZ4Ay5 m2r _|XɁ*-ڙgE?! ڶ ˆBf# kT3de W <-U&GS(1zQj:`5eqɪI:G##lռ|!>ŀ>t 2j\{ڸK⾋m c qM"֜`mTon"nۿc2@{u'J)q;`;D<I!<}0 Ќk7ef:t)$-T{&!`cHRj%a%Г$D:JIT!t2% ѼC2Y2}jBP-D*\_h~r|Ա /dwPJ=oa57+ʶj&yM2~Ǎ@WхͶ[UyvFѶ:b}R=wܫUi_GΣhƹ_B_Qto{a#3ooJܭ^1"!tMa! *4Zt}fΒf۵br0Mh/%&l:|KsoMp KJcQ`g==," WPJPY^'idZKAI~dh~Uz'qr.`}ߧ!B< _=OKϲ02Es?׼gX]+sz+,.%?\ǻw(Ǝu* ϱ PfFoS hK)DŽui3ȏ.x(}>?*TቛJ*qeҴ_6cA]qnO3,(ǁJ꼊R?&T`}JwX[Qk""[xa^5|La)Y B sr\YSkcfZ Q],fx>$3 B?0EfW99r=N Xz43 }һ{*E 7"Vݠjkd |9F-Vq*[b|l˃EDjC@lL I$RE4k22d*I 21Q%2352FEP,RR bl(4f2cb1*A A 5( HKLX6Zmƅ&ĐlZH5J lS"hHFF'yki#Fc!3/>yz++4 a^7榇q_?v<թJ]}7+UH[#K7ފl0pI,4ݲrV^ \^r]UAEr;J|f9TFEO}s~`'+7DM}'AOh_'mِM#O|c ntS6{!%se̝ NU6J n ` {?:K(yX0Yθ>U 9aq|ZS>/yUDr ']gi1&ݳ,ix6R}!\[",/!ceKABK #W'ecr;|MLa&}$MH1~9JW& 9m˨νjMT$ JܡxFUuZJ5S=>=I9p2Dަ |l/Ѣ-~#WβZ-bحZj'~OY(@j@ntZ]Ϧg+Of(5'1HAL@cZ6 VNZ97?np=E> ..b(Qq{._]o (׬YA"d<ߺyO]s}pae38}KMȢS/xf6~'0Åe'˝_`o-\YgΩLyMMibKKlЪ 5Ė !3,s BP[|b(7O@jrmUSyQTܰz§: ?M;\-oiwqp~de ŦHV~mjiz8/C}vjZ.N#T5J"R|9b "lv%&UOߋ|X ߛ~9"I a$VYI`:8bD횟|u>S Dm@?4;mLsإ{8t8,EE=flj*j5[ o:ľd|;vIE+p4NnA\g'/->y-F"9zߺ38W Ļ:";}Y3 wn$f=M.n"(2UF{}w:k‏|\ܟ;Yε YD"D4+Q嫕|XqOdYWd! @c'K=t 0&>l^CWo;CUiRz z8Q XW%M:d@ RyR$2kH@I8j5uZ= 'zKcAlYJgI >[ȩ?g,x58)&a@d.ϯ tnhrwh'Rd8޷^Hl|joYXVDK&dZ,٢pe#j(t) <M(/Bp;AxqS۞anP ?}퓻fNCWJ&9LOPiQZP!Zfg<ّI)!04F["bh\ Q]lE|fd "ٞ/r9lX<@갩ٞv:8y{~,$blmIQ~ EnEмT,"`x'« t5 eG\DV |i'Dzf.̔ R?к1r7'5EuBC_$vɻƹEf 5rpi.tP͡Oc'M=$E8~{T<-L l;&{dC"V)(]-B3moFQn%ĩ!Zhp?-۠+aVɯVRjFҮ,C(b҅C; nY(5!֒ hȇQ%+5kVy:uA՝(" JY+T3eA(cӮ;PRm[ ~J"Bʢkp/}g "#jbπ-ip9Y% +Y +#Mf`%ivǨ{3ܳPv>hɌdcĚǨ8|ձJ/ˆ5*Rx8[4S`T8'4,ak=1/z X`XUհKܱM~]mk(8']N {N{&kǺizlt+'11CvZRv$?m1:-y_ro?լ@ȌQ7j;[͓U$Mz *Hqd$vRI=V'9 mh7x[^X\ZK-6J?F5~NmJ~j?*zfHlQ[PIlbem9X WҌæXP:p.7mTs-b%Jx'`hy_GsW6۶lS{>WX 1Ϳ{Uyh1w-of?mә tL~$Nw|D!XπW"p`@ع,Y l*o>dΕ?ޣY&9tВz"ȤBOzkt  õJa D2;>my{_+7̿OF{t1d{n7덾(݃t)nM@p'1=;j%a#>f29$#4O6V(O -̤`+QQ:k|+SWgOaez 0 %m(='Ա=-ԩ=42ٶsؾQ%a1°A+S0:joeT@g3^{Fdž{0kktXe =m]c@QMzxl2%dJ&}d~s2 `uvFK.*@~Q%V+ +s.zæe}TPPp+k<8I .m`zJ=:u>tW9 H^JInl4gP\di%.h,۵AhrF2^]pi6̥< D/.4=%XxC ɲL)UIeAAl#t.e! Ȱ]dVe7N N+_Vr}:$띹d(֕#2~% G]#2% SV)6M12B*`+nQ@fT௲A\b-E2l#t&RڀGDZ$ZSVQz 8?o8ՠiP>+]\l0Q@v>~zHoK̜aEL9).n!Me/%._^'6@B^x*E`\ܜ푷a+J >kVO9RS `!͠Qy!PO}&C$y uvh<~dL4 |@ԡZ`yqyIJ`@)2U+) `~9:7; 6 L&@QKq|á%HB<'_kD1ӗłZak7i9+fj{~(_tT(F:.79 ?b;'V )x[RD<`ӓ`1~9Bar13'a?Q Q&(>I ѫZmTZ\ժihjesUzH36KP`>F$Yޢ!2{}5`d;NN4VM[6ifhRK+jW3?oUCv9g J7Yݦ̝<@i5tWȜǭt"9 DT FЫCȡ69ŢZISb![N^}ĞF 竫72j$& 9dX'0@O_(+@n}"ODFJ2+A_}hrH:;y>૤ȼfI,ˆm>cPM~sXK?P,EX^E WZ"&nOWͥ7 %:id:Zkr1+ JzL(?e/_D pf^RLǎT %)\&g)fUnjtg vI*ذWmѼt XqP7Qx"P/fqЅD1֧^5CGS9~AT9 =8RcFlH.Kņ QCWkUS}bhY d=ghȭQ2ecW3YoFďաtzk`zKv g4+ƀA ~~*M_1ǾzJtK;vlLʐ8&0c f0epɋ3Ǐ b)@\YKE\]NތRX&<*\jH×ꘪjPxH$(Y`O6PWNJ u2Y6EK 12n]V*- JPqIAG˭j3q-JYu|%;aJ;e 8^Ss1."(T eZ.0/7BTa֦:GjYA9gfn#̤#4mdGY)JMdurpޜwz ̧vGѹ9gg zYmdg6|9vڶ\D5{_w$=  L)(8m0O%>G4[Q~A?gtg6ŐϤd}ޕBCgWǰv$@ j$2 S_njdH0!@ ͥ:oF:H=WveS(9 -ov]d@>_/WM!)bH 5y$u9g<das_ ;=gF"nhC|ѧ؞a]:qFȁ$_@ΎL~;tY [R8`Zw k%>22l?)(u~LD㣶:Og6a鉍 z;q8X`-Pg/k }lqJ[8!ah3_a2;B⚼<s)AKq׻ʅxB)uMюYaO95gPyCY lhjWiٶ8:FNzvl _3ϺMǩ(2ßY;e-Y˸ʐi)ּye~o/ny"JQnCPgo[j0YД.El;`S v'GV*+7-6"€YXqyAw#6! "\h'+9bB)JU+8M%߭ɹ@Le8y-&۵iiC ~w3(ǪT+7]dDd%_lV\Av)[Y[\AJ"ŭ!{笆 :)JP %dģF([1=bҫS RR^U4PJU!f 8)Lvk J(+Whր1'EjP~$ܹJ+EvhӼXO6 "/^BN)TeRԡ:RJ@a*wEj}/@(15*e]ơA V1ߜ֠d0Wu_CN֠,H& G6ޣm 2$%f,kNл f|<.ַ*ԂȲ0q<wWUqȜn5[֛w')72od>V]2L0L@q#Q'1zRCNLPp]aʾ\fDw|]oy_myѢDhɥ2A F*Qa|>BeF#E;^5o^^^ \:0)wh M_MQ+D1 ִovpys:;>Tڱ1ɼsrȎ֊k]TW o˿i|jZY2F|Or*^8 4$P $Ji('q.ߜD2t@RbgN[2LcA\F1y6ƚ?L"bTACUu"Ձ2p}g>;b = ۆ6ʜT)əTdHQUs{^RHKĭ@B " Ã6!2\2@>srG <ϯ՟]_}W5ZC̿XxXcW7~tރH]/QĄVMj5Dź~xuIw2MsFLg?A=ms Ԅ<} .Ch gLp}V<+Yn缺.٤5|-efJuOA'jZ1,_4K曱/o~J⚫zZu2Ww^[i~OXt1daS`ظX * ]lI:&5%aܢ BRd=#WJ"e zJkZ{qM(^xpP>\.Ksp98o{`_l|wܗSS/!|X7ǒIYr3 P ;?9VU> iqܼ,ö@b%8&$h MmI4I ƂT`fyjV,mNhcR^Ƴ7ÀUȅPIJ6u)/lڽ&ZtПP/ \_zb|##ҷTި/1 "w{6sw&q~_1G-go'$l+,-_sJR6Ø.(N 8/xծ:g foRH\IbHÞ/ǯdd;[ez-ռ8GCTWn*68 ޓUjX6j^=kω[+$DulAfRhwI5՛oYa L=.e([S:<X+L{Yˠ۬@s,@BvO{SW<@_ 4)@u=)](ItARBK8̄)CY!O@H, $H'%?Jd^(1(2fBL= X3Ig z$ ~*R'@ڷtϕA&=-*1uK }zȲҢn\ҧWJ#C#}mzL_x3oF]=X!5RL@ [k7 5iծSB|$mU/~YƯ F{ a^}=wEpx.̵hQ6c\Ň TCe B q c0nF;&AmTdc(KˏPGΈx6;{?%PalhSwu9ϟ02&J+6U!lEE w_-"39k`0>YyTX6DsGpK&qfSq0J6z`FI oUZڃ4_ڻUj,VZ^ֳ28a E4.&khvqɽYr ATPQU$ӣKR3[CD0͟f Z( +C^/ & A:ق@[1"l yVgdX ^=^"-jVi*lHfق/N1X5HB&Rsv|$dž&Uk;oXqGrV؍'iYNg&%k[w7ŝ'wgaXU(yHQ8|B;*/= ϜVCgnj|z~tsݑش4x|Z!@gFPg@e Ah*%V|SP D :-͛/8y=+G81cBkr.Xm kYʱМD`b c߼g+?1v 465}cc 'ָA_F 0_*hCKȮ;땖ZU̪h12q:ϛqa"VV.JÉ9 X7ϵ=^E8+o޵~*KҚ3y;颕*~/?)wd1pG$I4/߷c%\KY 0 Kk"CzF(?)x%a<|-IDUZ!b4"T/Smu t]/;SE?"/]npakrbķt1\inlu{ &fX*_6$[zrWB ~W3铣5Ξz/S䙳PWtMwƪ֖bЎJ6Z/ c_6 S" I`m,D/4|_M$v~?rLKdoT I3!M3ɒ X$2Z-T2Po0}j+ei5\|A%+GMQoTZK%y* EPS-UۙٔLNnKK,߹p,4"$B+-U!fanC@-D4PIPps>.!8 yySI3݇Cv֐ Tdl?!$d%O$) vy:`$`H` 2%{́PamఐS&޺(LĠ4_%8_kњ+j˥C}N_E \ =Bْp5i6s{H-{Y/D+o{#-]TSzygA<¹F3G!Gr=,O: љձPwz`W_ϓXmyaWµ=%N*C$9&G`uStv|1<+vzOsf;)滭D61"H&-r ʙ 6_E\B? |QUE ش%)06E?C5G񱎻N5$V< EBG?68E{Ɗ0wN]./kLQ eK2@`)(S(zƔRjxxcyU'[BY/k3\{"F7j?edY=C0zI)dć+C[7BZl72@?ON-~*oӑPংHP%~Mn)&祉6 =:T1x8b}RB-Z` Ge;Tu֨|gI?C{?֊._Y_뜊O=e-W%"#^n7d<\v[L÷1~`kOaXH #hRr* .JP7UθmJ wvCCTL+}ޏҢH!h" BQb98\d%7iv~UGpg_IVlԧ"tgkC\b^Jc!: &Jbusz<'iXlJXa5R-r7oa;a?|~ݽwe԰nn=}BM&!dv a, ge~/k󎨢7b}``C/_< /Af`^j6BXDCXQ ŷ :6u?9tA; F]V','+rX!fbko ]%sX\,{ Qqqn3#^ͻ'"9nĔtغ{"(aeI*}j[C^o(Q~yKܻ&ssi81JWܓ wY ϋc$\$5 _ 3q~%% a6Eٵ1v#\/j Ca`k,5K[i,8u%*o;|B=A|!U4 Haࢶ5Φ`;\,QY5y32Y 444rK}e~xXjeL,Jy$K채ψoН D^c]$׸/[MXM3f ~Xu*S~nt/ޒZ,°BJP0x;ҟ_;ZMd/"JI$BL(#ELf$*wVWm6$֊E)kzMx QN+&a|Cbjyڷ ޭ@HY1 ;DZNNe {c[ wIob4_+t\ 4ѻ_1XuHajj)Θ7 B::H)(_ 7w-sٞb%Xt?._5u ͣDcX^5F;\+x^7X Ӧ5aӆz [Gt6ӤyUIWv[z,I; [lsO_,q@4ס$a RP"/uIxBd$CJS/?ct)>ĨލK֞N8iP.&U.=(=|QZ>iެݝ~5 biI_IN1"h:>%=#U 1Μ6 /{q'uqM"Ed6qkr¡<#w*@$flаDI{.$̠U'5QH|c ^gcǏh[oQ.ut mշ; JoBhԕk0H!d~I,-)bסO[h}x`䥅 %*%ٱ-@D$LY% PdHh C1@O=#i4YADa d*?*U&J<ܢ4\taux$|P X$#)w #0If$ $^[ج,5R) 7R>C ׫!VmӨ[˛Xfo_Uk#aB1ό "c7R< V:zh7=g1Y po-eVtut\˽-r -i@:o[Z][~r*M",qR,Jb ZAy6RC9h:xNwI*kު.pZM):لBX`iԾ]<}1bwUyD/`4MK:^Ϙ\Ƽa举'YHv(s&2!8KؖuAvw4?.xeSYsw @: z b6Oq'>W0ӛk{> 3/Aj^@y#q@'3ec^] Z+5e7#5XNuůr q؎bH(3Ě-i@PnqY )xK qJ캤B͆rYsr4QM`Uajɑltވ۹ze(|}yamR)鮕)Da:*ܠGzBPW]$;tNؒJN E09Le=iK}>Q eqG*(d][7Xd\L3ڒ{۵p^Z{m,#dJ`L%De5c{BܚXUFFX;4_l@VJ+:)jw;7'MJ5,X~vZ9dFf j.%# ^wqeN5N=o~7ﵴ5$w7찞JS((SC"zW;/S?Zi mz_E>+i{/Y\$w,u3>d9_+ Rv#C9 KԝH}b̖k[EtHH(<)WC74]sMr :ۃn3z)[=];'Oc[dSbLiA.1(Y19b0N(J/Q`D?dOwsͱcֻꎽgm{Y5S~RE6VY~p{C~db`26r}blHW=/ah2}#Ht)3 Ab`RC&֩c}onO-z}fj>ˆ9iA.gd$ɡP3 &[!A7:dW8˅Թo@cRL $!3!!1`Cc%HBVK I 5=}]Evz t>qwE(@88 UĒ2RA#Pfh`Af0e)SK&o #ۀaq.3ab9OerjuRӚPK-p$i48"0S 0$Ѐ~Ns*IEb˒-/]7]#Ί=iXжw"-UN_p2B8RZ0z9o \Lʋ6)Zٿ.ևiδ/ "H{{!=agzp/v6ӀUu=~,btZ`f܋t|P6E~RHde1YdR")o=#?WqUDI6!!"i RȸZ R>Jڎv ̓Ob6>ȰfQUj/(HjjO1ŌQ=?Fc?{ \P"2P{BqHvM=}3U:v뽕|GP{ ڶ; Ty+qo qþYV̐;f %5TpY-1^7;ۗK N6A?N+bV_"Ҡ>YiS]dGV E<ŭ6=z,90 D26\\l1Nd)ݔ _%evj@ X WU '۾pѯ˕6OʒWM3Y3uJm۟}~f?9sǧA Ac[6Y:R0R'I3gOH˧@j1UZk'LjE<盱li5}i$79D*eA`LӹGYIyY}Х#[H C%9eN Q SVo1Wmʸw0+7ԟoQ=/7a40(V>#STdš0Š+-u:9r\YzF1!H#kQF{?/xߦ㰆Je!LA}>ZRa][XR+Hi*^E^Y9,H Tgrd+R'O 0I7``OI"ѾZ浹msWbO+j 6I!PLrt=f@(CA@w `Yw0J{0(#R6g/x`xhXRkȔlc9U$mIOGugw4qoE_zTm]n<*>]Enw}W%L,䵑5$gV}dPA|al|=p2x?!ؤdY#  ㉆d/\P: zbAoB}CAθ*~1NLJԁ}?>g]xsn~L4R/|~mU"QUA )4Z 0I~ @M;`!]"exA.b!S 4׃\l2CP`i%Y~ >Қrsv/WQ_E?iI5 b^5C2|y@!4.U>9Åus{o;H_Zޟ毎2Y4q! 9/Kֈ!^Az}_U(?1 Hsڲ}(y Cu4WK2~w˄P_4aHDTFH\zTʩ IBSmt˩p\fsH+A .1IA=€PkRYv.JZ}aDY,[T0)5\qY|J1iJm,0.V ,BC$"ۘ1D~c1JЇnSUֶ4_{,v.x=]U~ZCjbt:~N=)z^Z|>mGSs-41X!czh?M0]CK_"oPrgҴv^:e晑<@vR?麸G$WYƻ\d~+Ey)nv~Jexv`("" Aٟ徺J[#U|~d4~Kf]ZФ9,f zLY+J???BE5G4ܧ`ING\ h|9uY{e<{z,Wa睄F >D@5Bed(xɞČn фLJ*Q`2@I$aIA$%d,2@(" !(d0MK R%)H@L%ɒ`a PQ u@ DKcbh%ql!%+ƚmIk|lK֩.M!S!Qѹ/.i+;L\ R)n T *"U{ŘAƽ̂J-$Z=[@ o]zLo!0E)=+ym/9/c>/;eDDGPgrYۚvi89vh{1zܹ=^z|ɴ _?Np~ovD:,# *K Xa_qMG{C}W+нw߁lSCԀtŭxަ T,4 }MTLq8C8({g9H̡DM߈@&&7jӊnGRI1 ?e]O Z:UcF؋b QqHAs=#>nSoN+8 Dy/tAcZif=VBX9 t9PL gs>=mr\Ubg{~N>; GRaZ1<9w Qg|mjxKLNHFU?]ȃy;5x^Ef`ɿ}kQڮlU*ʂ2Rcj?AM;CO+}{M28in0k-s|7n 6f @@1ppp7wM nPXV wǬ,u9n}2zxӦ]qulC?{vW_ϼy;ג> U*վٟs9@ȇ4uuUw?̦Ti{P6uPZc|w-kXb 䢅R jn_'>wlaFnƱp;v:2T(Or׺ S >zcy<NJ(ӗg]_kLjs}LD)|ON_ GY[9`u (+y]i *R P>6!G\2; H-}wߩ?erS~nT0RȉFd HֵpC`_}AUm!5{M3~Qs1C`b_-8(&mi8dj:"ΐ/o{EaTꍨ?)3##KȜqq~t{w/ۣ_kgz_ˮ"=_۾>gsdCi(~߭yoL=w$%|-wv&[uEX څDU<+x?YO6Qj;u1^ԥ 湲m cdi)CxsОxy? #?(I4% 4|TݞQ̎N?S>ym}E ݻcOm81a0tz?u c=n٢I{wp,ߦ3sPQ2?P js|} iV_c?;'55,wBq{ר>,?u Z1L2v+W[=6D^r]%%Z!Y Pr[W+"v_azO9tC}nMtQqA{Ⴁ$ɻ{K"II) (SjZ[ <87OW#@Cep,a`RZwZPy鏎Tǯ5kP* e7ݍc鈰!;S'?~ٿR2"S% [DjۗUxٞ I>Z2ښ)/߉k޸z=oU/A bDx,D]9`W&feE3cX2J|ʖ|'9|7)k%M|5huWċDj%)}a]cu%pCFCESaV(6t6ǡ=>J^b/6F{`zwK$.Ф (sPͯ"fn  @MjcFد<ݭ n+7)HVŬb"ia+?d-{/"5$Npc' ;г`A) ux)pIw١l/pXk{U0~?P9cmEUHD(gc[;zNjh諐T0/)"8EIF eoYkV#?:h5T)M9KU(f*r6/=Wd-|1XkKlNΌ3 t-hX`܊:>@ YE K-.V'QlLCEٳƉ{)_q~0EM;+6Qx*85{C[wV*&KSrslwhC>mCPvzA~b) Qw|uoK޾%+d wtLz?6rzkOPc7ߨ}S*"GL& 9P^IЯo7++L-uD:0!#G~l ݏ?B nu@U[)tF5/5jF<ǮIh:To``v]RL>v7%$, !$Z@R|$11L DMy}11 0H>rB¶}Zl@>${ByY$ Z# w6xjٍ@qBtimĸQio)i81ޯ[tY7yfꬽTuO}qOUjQܣqk(7`b1'LQe9Z}֡jL J0;OC$P/$]U:eL}nF4Y/ӝcL>dF2=`"E')P/^|6}ѤB* Yg,HHbz]Y &l-Gg_%.ٷ4@'1@dAxԛ>5۟ S B X cjpߗ;n;T?ٵ!) ?z}GӦ i]M>?x^?抿$Ӈ}=v"IЖ~l1V(S8]=tp/d!`LqsfdC1p.OG3s'}e@-}t#A|,w}ataPvBho7?[s$r2x.F 0 @ .d1ռ"8 E* ,VE!k4/Է[k^54%bdĤ*E?[:~&9<DzFQHSAbR,Dzi8ji8~2;e:eD&Ug1-Skl&>\q!{T2$QXu),c_ET=u;*s}~ #) r =I1SQgAe)DH DI"KC!Aie+Zۤ@iSRhĥg)~Q?'q{.J~- LXۦR=a)^z,aMe%45,Pʙ_"X']"LY9@n0jH %!LBTÃ~i_5.x>[\aƤ,(DɍkvW*C.*T Es5{~o쿵62D$U+ZӐ@$@\i5i&/.l<8B7{\a}lU _??iϥ!~šOW:L~#-reA9m{W=eqN{T2V#d'۟3C<5< yĪ6~ gqє|qm[(!yמ]p\{6mT+V)DV:kLh^kRD@./G \?r 7[P"VU˪7xS} ~-31s2M͉HDo`ga)z~}Hj_`LW1!IU4W8Xc:A$0hkîD g}F[Jۃ;b6 01|AG_[@'ys%3cB[S;" Su!.ۖ;VkSQi.ɋ4BS  VܾD*i(Aإq Td^2(H}*؎za6P'ԯq oHd/@:ƨ4#!Y)Jdгh{9בcL"ode|XT̉黹b nafo-^XWJ%ٻQH~' Ho= ғO1)rY(@RŌ| wL#ٽTֿMn $HMGiPZ[sc{^$us6jc6P$-ok:̤Il$! FI4黮)i/z&R <&֏eir܂|X޴&.(.%&R>)]4+1)S#l/a^#-Րm EDgbymOgjVV5@ʳyqC&Lۓ:y/f1Zy K=chb?CΈ!QcZV@RTȚ 6&50|[ Lf}fE0.B`kV=hh_)L=vux=|#VŷzO+-ѩ MP0l% ++ @7;0yE4iib2JOu;x@Őx^]%jW`NhstYjh Ϧq?E5!< O/~~+Ch=ɓ R%?.i(Cwgk$D,IsM @Z½*F3X}gL|B%Gp.b0&7[?ѩ"&O]l_ή|oS. /ʦ Hfh&b "?=t<__?1/$/AkwIp`_LJHEVS@DZ5C! F뼘`=>F\W<ۼYY5N\2m$HD@^6!m1#MiB^ Bƒ!uҮB@|H®cX" KfږK4ʌ4[ u%Q"UQld52bV>0MOH+:=آ=ZmW*'ϻ2dr$In|\{k<6mt?)^4viTut5-C#d}φR Ȫ AS1h1'WFcbF>O.|$To׭ QEPYFNUeYZ-rzVl(0dD$=WPrR3p}Ceo- Wp1(SgNB@#XcDm30kz̏ff񻮏>jW(xsCůrɌ[ݷݵvkQEs\r μxQWэAj-KO~N>@:u 6KY%آPL}׾__#L}{2>vT=Δ_X":ug>wI9!gJ?)w%`3L jD>!J~+70z;9咅/x$CfH+0Ī( +6Y" Ä!W2=d~ץ~g7w5"xZ'zFE%'fJcl{\p%Q1,Ȍ.Y׫ 2X4.cAz#IDb0U$(`M'?lfG!5L)`sLJJז*xY,hNY , 0fiz4ⶹRXc7Іu$h.߭F'捁[uew`JTޭ/İdkz%_K|{H;'yzO]akc=fr{t5vTI 姩qDHWPVAIak^[} #h T=xӻ_P"9Bk)u+أ޺@੓ q k $9Nu]7GI}|Ԡzr]f;@nOs{étwNf<._Gc$e&_@g/ّQXL7"1D6r #+(4*\ # ꁹ~ۑ |H9-rLH%-ο+B@"^,Xk |pZx/ ¾ [)#„DCuHx!yoqÊ!g֞5SG'bZ!>Nk+wo圇kOpVK &XDzhVRVjA:6C]>B\HL5Tlp䫶( 7  pmv$G\73LJ]@2U!@ ye8=ьpE/eh6xG7'"cr"^(U_o^z.£ucM;x_)^wdV>*zc,4wnX$^rMiب/i1W1( R_x׮ơJFt{[>yjA7F"1a礩;9:};D{۞%@HwDH#lc\o1g7Ha B'~Jݣi׉en"ŋ(ױfcA8.'*s QĄ3RЗ" "X4JBpaʼnrd ]V_Fxч`54)^bbdN?>l'2*vg>oiAkϴoԠ]N﫨zM,>"s6B~cR~ SIm)]RL>|+g1{0t8=57!&(=A&ҝP@ vDdsXԜfZ:'t|L˂$h~F;Ɲ^=|zͮ7l lc @1Ո1 @7T e #3JC<4[{?cx-z?tNbR_5q/oݣɄDeڽD nM!`G&J?}b독V[IK W!lot /i( r;K]#ɸVv. N&y- 4M%><;dYw;!~֖7wDAE}@d7I"RX6#wK`4fـ4#Y-3ٞS RC#1VWH\R{`$= 0h \5T|p%L aZBzvK]z)`W{/,Wxúyy^&wqytN\_8z͊`.n̤8*~Zk"{mj^E_gGZo!SF,{W|绽E*/q ^t]EaQ B6`.10|N|߃M6Yj B0VM&#`'ZZ4Ff&1qU(6Bݼ1&0 n 0kTV65?/7.z.5FAYfm9 }bKHJ:G.pGt+32ƌM) B`5iF艁?gI~OuZ!۾ ;u D0QF>r$K^Xg&Q@#㭚2?Iw|Y/B+&JZoz=.oscɜz>j*z :DdA&(u5VƅbuG:Ӫ*_5Ih6b gID u,{ϓ;|01'K̩l[)dMǙϻeh%0T\8Sf.CuϷP1[o#!@1mLT_ g1Nxfio"4W{ ׀şW}UC_ 5 sqABBeyxԖ tm(QVS v-m\L?$(&<=xm6o~N[[]:@IqDhy:©NkBhğ\WD; I^"IFώߦAeow_'_lsgN˒K"{ Yܷh=\@l\5O<E[*,{0V9lot?OpwO[nl>؃Mg#|*L/'R(uy]&01{~#F!nzZ5m eºe:m} 3H.]`&#Jnža2E/4S$䍩Ilٳcj|/E߹j6oQR՗b~%WyFM$sLF @#tflnyͯ3.m3ƏvĜxg7| ~"ݡ4H3Mz[rfǧE6\m}G¢3Gpb4Dno00~t˰w\0(΄!8◜Ǐ a74٠B^7A Hsf7f54O[@qỵV%t}ۋ=&RM mʧ1V iD:)w|)ZZSGuu7x1GX"TgD_\0G mP;z q;q[uH_WǮ\|}|[ c0TՇ=3aWL<QrD@d7j٘UjTZ;'B=R-0Rӟ:vw M0$e9ZA$oXAWoD Zm.tb(Aq'pnۼ'aZ@&!$NI #Ucdם=c^79Ú7;4Wdhy9uk<]ʗ jlR6,+TUPvL,-RRPņ K6_ ưS5AnXr}_u5!&Ծw]_;#;,`㦅}r72I3BHk4#]s~G]oWlbcj=^(_?$|{ȫz.(,F Cyeq'm総G[R@f}`e2g+{kIÞ\\nl EEfTsrD ARSWz7PYfxuN/ =o].L"%'$@5 Y%-!ww 0SY6kടr 5lrh2 IcN EMX4!sJ =pUGDYs5i T;^XyU~Yqt|_/Eh\z O#ԓY%RS UJ)V`fcOYл-ahҴ=(E`S./G( @wzU_%pj%^`| ^)ǐbd.8E["w9гC$AnG!K gȃ||o\W1S:A/^$gi>M@ b+Qn$=Uu?+3z\5_\1!"TAbdVIh!5pg "a_awF-}S{Dw1#ew~¸/֯zN@V |RAmЮX):B=T4f m* ~EѤHR4TA_7;;E/^^uo*0 vMr !|YĄMYfDu&<1U ^-o_?'}`3! uU u%̧Bs!="evkc^vG4y_Rӭ^F` Ov\ nn2y"Dq |MB\"L DC A̒4;iy3pGd}G"$[XDm,GFh"#2Rhهt0 ʡYHGb4y^gYˀCEQ\x3ygq b:J7>[ޛUƵ@ ([q%.@fKvZ{wk^iI~7ȁ7ک lZQǃ)v\#ZE$~oCJDQt q,]k,+vO>::p5s[;oW|A,F : 8AerWVφ5%9%c$D:)ofn2쨝}/Ԡ`ӭ<m>Zԫ|rH882AgBZtFMoٻb|AIu7EYuqzT"TpV@ܛMFgwEq+E M@I1_+lsxWMB 37Exύry bBK ⿽P5C?*ܐd ^~saLCMcz$N$kЙk00oy<}T_,h854T?-w#.4 ~hqwsj;^ԎaѸ ZFhSJrOw qf I\o9-KBo1l"#c?,dJ8$I':dޙ # RYHVl] A٣۾ͬj\~lU) I۹S- H$ ww7vtNNw^9<v]|/l}R}б + ,ڬElݴj٠SIt.0)YqI:,Z49| _ᕒXD0ޘ{kiEqh5;ٲ}N[aI& Zq|o䱎 9X;Nw YfF }- PMHkaQFObn+W~/XWހ[mh\ mDDByyHYgIh~_gQaFTjdx)fm=ǭ [g+1vxeOLXש!b=+I%3z%+v)};7{u:׾}cO6)1B33 r`lHCP`p:=*џ . =b X% i0#lzx ޼׀mகs}mbu(jFߠ?@< P1:rԨpT.gOdXC$I ]FifƁ2$1Ȑ"V\d9 ;Pk(˪60՝K<y8|P\JA)Ok,G'%w7g`ayN/i헫C*}lByīBrEbT39B&=g!:1sε&O0 b?&bz<Fx!MW>X@u6PVGHi2:G6xVo.`]NF]7ި3u}{#/]߼[8{ɝ|᳆jq(&qHҌxXN_w"鶼e%c4&;S/CPv hu{iyv)~ֵ+ ,`C]:~?sdcb~p!6b ]@Rq,k+ ]}w}8 zldD z#W > c{RY#r7p$ ]T\AܥLٓ,l9 7|Y{"",a њwdk Ztv[,p{tV1vXEX @"(ϢtX.T96ouOJ/um܉cQ*BϭԐ-Y]"Cek.1SL'9׊/^9t]nz9S^VJ/,I+9-S(ˣ?IL3-hճAnkO8(8A(f}I{Tt72ZürSAH`nw æglhoJh)ecbP*V6# gXILPOe]]ű"RAA'7戈}~?ӥT 9`P3(@~x|M4njP*1IYy\+s<٬IvX׎pe70}f[Z5fM"}do[BfORu__q]@AȐBͨb6NnH8ѐ4Ht_QcaRHYdd_[Ӫp2G n]k/k?j,:d0i\>=c #8 6aabʹ@!HR}W<(>4(1q^Z=VrhM6=0B9u, xd'd:APA  +?~zjvfL_PX.:E=p^ghf&}eHԚjvqvI)Xfh -g[g_=~;HF0>e96HDG#iڶ)!dr<ir#H_ZiKM+[а⡝,@۽9!Qbt_?6k7?PFy;'<TW@ "zҶ4;T'PzXa#& C;čǓ'vWQ~[LwQkc%⬱~yBDof,2 @kE{Dj6& )ϭ엤gȿd{5^PHo9*-,vW c )`j"m`̵635$)K{n+x_oI)鳡xBh%kβM^6eedb4ᒒ1z?ԟ`5WB}kM;6| H˧,K@ #LKa<5o{ysx{CRԡ10,{[I7W @-  %ġ)ӟ3NI<:IcWH//ҬG%%:x6qgt$*.ZR˜Yipx>"4 0Qz4(@S@@A%Vl2چi?BDD*Ą *x#jD'1A,_`ﳎɔ:F>3w )8/ѽ@4}S W*d%0JFLrJNQ/.nUAp[,b\l&g7[]y!nSw\_1$"wŷW2v3[u!w]V[CaI8@?S@P1wmNty8p(|vLCJ"CJAssR5n6 i[t^|LRO "iߍ^c@yf'v9E5iBim#2Ҧ8\?"izv>K_dϤyo㮑ޞv='A:%-I LAa &$D%@ fp/٘rJÀ+?aDz"D_)]FܻB˼o_4ru>"{UfuwO+W{[o0"yY{C6PCN.r1fĝs?ՙa.G`z]$r(pĸCp)#a G:yr1<&_C?Z"/JvԈ(ړg{nb'(vG/;,^xU& !S"0-cCxw͛&ٕm0Q&h;9V |E)Ses/>A"hӤc\sAvW_uE?֔".ҵig6#F>y̗ PrW&ֱ`:,}N|l'&KE7"|H"D@*7T;!-ζ.eZ׸Q$5Ϋd/Px:N.J{!Oͺ;- f2.%8S8<>nR@[ſO+zr50Ou]AcbNsu $n`k$۱lݿ[hOvV&xw@ @Asn)=3J+撁_NwXGWysC &hV? z},oeE-0~%=6B 1Jk*o9i Wб6^Ahzn Qv\5M$^LyӃ4 M 5δ?@PkkB)Ԏ|?GrAO*') "Bfe?7pELL%$D J`2M"d͊H-@ &$0PHmH3ޥ8:<=7wHĨA—R%ɒ=O"L$`e(/l֐Q02$͢H$9A'Y)mI v Ytk89TެpCc϶Dv]nnV(R۪,IVkߡmIk(i%*Ht5*_7Vb+JEOGzWuڔ6[ E)ȉILH f`fɑMc_y{Ʃ&ZEB1 "UTz Oz3'æT١(^l:4g]0W&v\*}g\H?+B)͡;XCf6EE]@j8j MBS}YcH sߙ챽Ҫp8,(. !Y,R^ p0shh,x>Cr Ir.Amёq7`$e :@AݔX$|j~{d]!bt(]>QD/6-1}T;'b/5!).~mMVyogr^iyvp5,'q+v-#ΌD )ʨ7XϳWpBbXEi071ZW(:uy}lr5uUabB0?& T]UCH9[,c bCy{ڿ ɶ ^UՉ{A^?}vHS?8b!놾<XDLC&  DplsRuل?a`1uCUj4_n>S\yL(WJ{.z<߽_wɩ~svyavAeM9Z;dޏ]"J}TKS \˗|z)짒U61a=mrf Ɣ8P}q,QQy)Z*G@ iB(i#^2眸/tM/`)Hc?i:b*9G *}nnY`ursy品{xw;H%)YtUȆ)9Rq#qCChE?邧OfjF`/І *)ran:,>*GߒP0kv a=~8(? ht"w#fǿx*6h\nJq ytyr6CY'HJK*WTc2== 'e*s/SWkroO PSN6=*ZƸJb!k@&ARV5+ 8Sa}w4h |:F+آ!.]^=>5Hqt ,G>v ]]̸d`}i"(^;:H#/YzlmРBm:3N+XrdT@a0qBX:j:mQi9b2j>8"g(;w|twY D,eu[OFcefNz D?VLYW(үX 0xD &<d>ybmUE@6&+ouiiu,?' BER ,D-53;R|ڡ}/-I/ߤ> < pIEeFDZ.gze#X:᫴~`*`'-{#߽4gO3jZNGƀ'g>24*݁' ] ꮕCig lS ]~/ `/o>ߺ4#6AO%=f*uG]g`Z!Xq@3 OGOHbhw==N9ZncOƹsKwrd :5>UFiA 3 # dIPUʫk/r׿w WRؾQ>?kds8ԉ j!CkxV\SBԙn`J>+=) $f$[= [KØ*QwJM qPPKY4 @"?w=]l 8?}5,':,25A 3[u K(f~̓`p% $Z.e 0"s|RR# Ʀg5nG5 רs>@&| GPga8ONHYX<>ۿ"8KQv]tmএ"14>}A O<#-?C>7;˩> [~,lJA"}Y1:0IE/֏gX1qˑ(/Jgx=|D g(ꩋҩBJFP/@CHMfEĿe5;A"B% rEul=-|x;'ɿgZvsl1T_!J.Vg};HEFڹ,Fe{[.Thz& 3 =o^2MT&KZOR`=ұe_=׎uEP$IF^[ ,SPAD?qRA,DKp) #rHJnFrozE<*d";{LXl%ͪ"֫!-Ji2LIU/]ߨ/Jwv za"g)ydLn`3n k'' h϶޴u0lהG&^BPi(.ow bĕD\GXe\ߏ S1JK Acg*=2"ǤyΓd&D6lRa. }6}M62ٻޔa B$J_D)#눀K@-W~WM_q1ߒ(f5AycJŒ|S«['ɹc^ ѰuKcIA"Zarz]d#U{CbP>]K8Mh:hr N 0n?(z |S"3,H4=pe=|80鸒< ?P+qשT;s_4i%e hM><,ӈhQd8p@ 𚮲cJ[(JrJ`u/fMUY?QwdTHYݺnM_艢=>Sy]^$bHd!Ra 8i{D?ȯS{8NC  <[;aPCd_DӘ4muȏqW]0̩Ia-_.ZEAQ k4lϾ;Fa ՀPo(v+@^%RJv)X"A".Y?H+9 {)M}Wq]P^vt#6lVٽvZ{M ƒ@pr^"G_(m q v16O02ow!J2gYOT$ڠg$$B 9C Dna ~* `n6F6!_)oK6x̩dfمKp*RP"/~:l`\WlFxZ? NU|r\w,a}yVhI[Z0Y\^MW2+wpI͆Ի12%X|otuOru DBTl C" Q.}ϯ8x3# YOmba-,FBq 5ƕL2F<:zegUf+tѲJgك5R 'aI57v=]NWH:h>(;F l'(qw\[;qF+m?Ծ$,衜l)]mϵNS%=C$1<].灆9Ew0S͇5D IJ3]oZ¦ֹdl+wC4N  U@)5U3]:{gnuTyUP8NUG^8Mw hAfɪ{ SA_9 &&à䵎]. ǿ}5-ݘ=vBЁ [4c͂[3}}-3widw5* 'nL7YUf1MIWճ*=\хIaD/YZ12yhw)cnF}Կ!07du})R b91,^ZŶ6^FGD2oױ,3U]xN15uK!Mtbep Ś^fMZ[ K3Q)ky|;>i`V_d;9TCANv:AaULG1'qA\3ղȧUDS~bb?d6" . -P#]Y#I d!+{1DFH9t~|@n[C{SOK]ꐽѲ=r'$We= 75{ ՞TPjJ_dp ?~*Egu ç1Afa-ws cgNn־bB DrRw3vHEuu7vQI$9 3&51L"ġ$ }:ujsϳ<<ܱMĖIѕj^];L*^ '[b[o8coN :\k ~/NJeObGW0Htؓ>Qse3KHR!I 3z?M*JJ hab,#Ԧ4$+?:nhݠ0[eFL _cwVS(ьAR`I~iK!$@-OU}& +( @Dh %i@uS)S=-w @TډI nII'*^ z+NuYܨK=jD~c J`@$s>r/NVF U`,-r\lf痞. ("UDdKwc{\=#TqGGcɡ}N~o a=QpIY+"TcD[b*6h6b(؋ ~W Dv;LǹKo =/6VX# ^Oo9&=qI FSzN>+ \Kop-ڕ2F:^&e8oj"j~_3v#Yc:^t(N'DsY}դ[,j-:5@"],0dH<睍fm#K!ufd|wgX Ui J`.}et,;" KooUN!jYlt%5 =)d~ &2ihO3(LS/+Q S3Tloo>I?&Kj"3D\0_1e=j@-_Pq߾lD8K:6 }ĥ YV G=Ƣ_. [%ǽvȞGaN'G(f$ tvFkBx̾[%YWlw%o~scsݫ& e%UI8@$S,ukaQ4JJ/RbşvLn(X.X3]mJ/6 nay<vi(Uv-mkYr$B&:vR iRu+ol^ՕDD: Y01Āi I*c[ݾ!)enh&H]Q)k_yfL:ċ "`.(7vv;vQBb¡k8rzC3UБ㦴7epܙҽu=YZX I;PIbx=9zz;[ӽZjj%*\)#6`,jd'֯IIC<Ǻ;iY1ihQk#~q{Һ!V7Z6I.B>sGKñǙˤo/?*GžÃnoH-@0Crk7tg2y".fʤ4v1eK\_f bO'?N"[(H"xCD63x|<f|laPBbpb15H+3~A!SeNMT^YH=?͊b$j ^wM|D̔D' _KEy8u닋ǐ67}#{ox>VwC\}F!.w̜H ]Z"+=̈LӝDmJiiR@>ojo@V[RikYBM^xo;P?"\~lFjtkdiUu Y mPX m0z & l^[Cox/(G3{YW`w UpfP1: %>grr~q;^3/{׷Sew_g#ʔ>C̏zd'H$ L$Wy>OtGB%@)>L8^KzOr31\"pQ35+o8T1#żM?;DoDJ{5Mjígd|%l~bó= fSVJ!<)$M5 !L"ta aJ9u\8,<a 0rG}9) ^/Djy~U}8VGNCY7U+m'ܤO Q9U{'?H#NwHMI2='^~:",Gh[9N-Kp[r2Vޟ5^T4'nfc7+#}5Q1GTK??ܼ^^*x{N \)l).t 'W|ݑK޳S щi:XH/ﲿE]i;zgVË́e~o6|. F~LJd E L!!%U $DH2LH%bq( ;yn׭77NI- &!A0Tb=3kr|-ǝvy:II{S>F2<#uqSo$ m;&J-b~tjF1u]F3(@}q͝GWҤт<<a %;~be .=ۺm,`䤮DN`iE@;j]G]OxA"cY7lQ'$/Pp v$&Dz(jMNc9(FЎ5LF @ ͯHOK$?P(gtEXzM#ߎbGk~ozuf5Q>pZ7 b&dJ8/=;|6O⬯ҊjPM`|!X񈀄eibP;et^P<^6m8ekn2W_￮p߬@/2B?:{/+Y[ S|{ :KٲRB' Mj p3GN?;4#o¥1VHϘyԛŎ|O!nx2e [p!ظ fH0xw₤rH9.[$tx9|L# b}{oWoOeY Z@~?~;"T9u=9x vf(Gٲ-]&Se`[v^fU-c2z2]=V%njdZ:7Acyu+p~O=BWC;IOzS]pZ'9Vmǹ/ړGp$"AN,ߌ*g noy;z8eHl9W9n9C'%82{6XɃ {nѩOw3iw˚9e)y!lկV{g''zHbn:ʡP dBE!1+gltZVUKXJ2yjłi=1>cSg-?8{ΚnXDH䏵ۗYob=BU+ xiD/Y ]_a(n]WM'.=p:}9-h.n CӿF5Б޺MgOLrH<yk:>OPNJTnOh$M|R\2~yi1 ^,e.F$ѽKx4^AE*.~f0fH_q8z^ScyE륿 D"'C!i!^'YqHD_a}ξy[{ǶW @㠑pdնngx)yxH0c0>@M4{ߝC|f9,A2`H=W`Rs菛l"{q{"?grLkbD1 p$MY}gP/Bpdmr C@'n^ą6QD?^iYŁRtMŒ Gf 2q3H6`^$bDy4PJ& iNjB#GVVI7PzNGT2O-گ/ůAR?7}mCa;b4Zf9Ҵ etmQ{.FZq/ Aaąd010/VFԪ̃gn|XOe& @p%i DoPf4W ݃f۷<q^iw^B(s 5؜t\+ou;}+x6Uk뮰]aܼȋ\5qp]pM~R e$cFtf 2\Љ C~5Zu~ԕMpk ɾGQz&Y^bLG?om;'֗) j<*㯕(QWOwN/b<@^fٺ>\IQ` r-'e8vܗ`r(=$CK p[i CV@Z`% @?ןΡy&A5BC>9ߘho+*C;٫7K%vN-`\/r.0QFS#8a⮑Uș]hqk&=T5iz|1u=kzS*4bZ gmEe6m2ʈ+"X5~k͒h(( U G.t&M=ZRaG10@anBPF@== 1!3+dOK2D [ErS$L J34dENsױgǦO- LAđ#~5%nzI\:YKNz.3庢e@J2#Wڻ}NrLX #3{ xjɺRaN\ri#Z]P\zN<ڴòn0y_آ2P (z,u]wz+_$\d81SV^hV JPE!J!r=lѰph=53 Ya^Ŋm30v1S=ߐ0Ĉ́=<_vwty&YsmwFʒwlw Awܵ3wj0]- kIJǃYK8z5{c6xGo7Qz&ݮ+J?nUF|uԯSxvZ [nޥ_'' FwD3zX㢗k}χڧڬ|7LԲ1[V{LlU, =cl$} E/E?h47:HH9Os;P-j ,n޿]K;ա'^B[)Cga]; p0f#8XD9pv3~_venwP.YbcY-Hηc;w+ Ú { m߷{?wm~p6--:<r#m^ % C|\t3 c,pߡyvqMCcP&x)Atb 4UXf{$Kp0Ksnw'tqdCY toA;|` Lm$c@>t}0x1|DmS޴/>aH^_/.t3$X?CouiF߹H~"뜦ЅyPd6~3z6rNY(}ܔF BTfKjY8 |$ 谨%0oӭ7N.>P⯸I{g,,SuYf=OCFmx@&=LKEFS)LWś*eAڡ"r4\IX,ʏi(D5"F[ezqQ%F$_ h(;F)*)>{mno bAR1>ry~h .8->GA9,"c>Rji3f蝠EJSw^%2N3SY! MA{X 8eGlL߉\C-ye֢P*L4<;8̂j58fA)u^% =6o>q-^S)Yr[Eײ19o`!F6ײvHj uBHdx~ñxyz3!/AJhUcUTBV'p "Y((c &  Z!ҝne 2&q[Kc|Ş7WybsqXZxp 0#1AqA84Bۥf:_َQ\OļeC>߮5WBH }V6'[n"\PBj*ųR.YĩQbca宍XpGLvhbBх:f9&4(vs3<(ctӄJɘQb7̣Gj_U*5 mg fSS U 5)ѳWBb<ߟ<>jUv(^@ݽ wG&~0)6#- 1(W Zv.i^{5g7FcU&yg )#wH@]<˟0F'ȅ&Y ћVA+;_cVbb]g8T8e7at/:HMaM68z _1T '8r[\C.k7G%v?gie'Iz0lbv6uYZyڵ ,^Y)e<> !g`XGz}v޶C3pUL F-M!Y|HОl~i&[E `Ҷ,[KI}f%%]a []mbqK-)o<«jۏZ!k.aTjRt8ef$M:#DYՁ, e+JRZ&`L:a;:D8_<5$`EOaēg<MhX:.ORKM []ހ̢L|WkV"lg;&]-ś6 Ft}n(\r%zr=L&jF_Cq%@0ZpVuԖc/$`RTlrͺ7V}C# a)V3lҎy}){,M%XX_ԭg*Y=Ɗ`#!IGn yxh5?pR(Y]A{҉@Fna=2i#GzŕX/mM..m?_c6tbcxu ?ڢJ<\;"շ*D= n<>SkHymDnӍ!ltBLKpTzV 9c^aϥ^TZ*cxc2czg[ՠm]h:hfd~=Ro-ɖ`A^hb5)-[VbTf7Eק18ΜdeGFGiik$iDJO$VѮFR{n3cfl%CHǰ+snl= B5-F8HIAB6Ef;똁£m -6c)EUY!e߃+M6ˏ587?/f0bM㵒gA1E9;H%VKKzaU(!u <2l'CrC W4kd; wRDR<bd-Ir0pʂӒ4q'!{eVвcuN1CXZ&>u ZDLoY6 '4*葬al^'4<+7x|H!E@8myva]4XK}B%(me\7 .9vU-dlis݀8+c٨ﭙ2-t'AlM{tqE{ɭFn8$Ejp>Pk_~HY~&rL lXFQk:V.I sr 1Ogک&l+ȕDi> ·IWH+(%̙L))7.9--%xip>|7=a'vGr,.̋9Dp̕Jո* l$rs7˽=}óһj;d[<2Q  [5+&9m43)x Ǵ`͍+.9?paEp32Ѥ~=nNE<}[LRZ_α<0 <)]dBgu08OoC3}[;&bDAya`:2Sx eb{p]tPŮ.-im ou5[r ƬuMڒBw*pLoe ?+:w 9vݩML$ջSR z$h5n_OK1R:Qb&vWʴHvgM*㙲a|y13#aO8 @9yu fP15Y}B6ѣ](hWɻYsu֥FX/W[[Ojrp䒗rY,XD@ͤCgr{0:FqHgYtaQ:_vɈ/ז=;R ?K^.%E2K&m^#// ǚʴjsh|DL98Ɓ}7GLr tV֖x*?T~ Q(KwwG ^Bc)t",Lš^>"þh( Nia"v'^ʉٰ 1ysQ   0 #|s*\?r xin-B2¯2#EXFZ(2 $?)HD#rCv)k7wO<9[omy;U(]w/K.))*4ܪWfg )ƣW>j[.=/|?7vQ(y ?_;X~vm;v[=l.H\~ѴAS\ {W%wJlIX@}*tFn2 |mCW07Tiעq;РF1f7ɂ1UtsY(b~C %4{uhTQEj{~m:f,ÅAHM뺏ܯ}߶_'d%i1FR$/Q Dǩ%S[d d lGm7ރ$ipΏu; VFΣ{Ԣ'r ϟs"-׍YV2 k׻a6B81I/%\y'yN-~uR]uTVQYbgCuVW>Ǿ8Ĵ* 6/; R_?iO-|_65lDcx,^vX`nB=Өݯyfb`k۝H΍0igq00ﺖ?Zkf٬`%#UeF4L!ŕVYPLDѻUUnE!XaA8HCdWշSOk i1dg'Ӎ9Hy2Y+R n((M C ij(r]V5VCL'0\ƈb[D4ي{l Z8k0JAbߧ} mm8W_yj"0|W6֨ e _+ζUsHϘZsP6ˑh(r$Q gAA251  =se tJ&LģdzeWzU<3-mLC ˆ!D ;D6 :ͤCwe{sʹ}wb\8of4\קwBoiD-y$M]M"gic1Zu&4DGC(!{Y{䳾|}jHEvtZHdu.uu8fN!F>^EC ˚-"nzw2qD`*n#x?6ܤTZTIlWi"+#2K'26S_\ىgK of:)'pXԨ)mbN 4!{8 7(n6'e+$\ e>{$ Y*WCG1o W11Jn\!#w荛+oCL?ux#Ȥ˭r(|*NŸ'î=KB&"^7kۜn,@kj)/AȪҙTBz+#tՂ[Q|RG"5`$.% %k Qn/0$nORsCʏNOx[:;|F;Î86& ,~uW{ꌡ.3qt0P+X'?X(mJ!yM#ü6De+ySi955H4, 22N~`U4J9" $طĝ0JY{ ]Π*Dm&7rV7hO !y{ߜtWy(8=&wZZ| kƥcXÿ$Wm]M(5il޷W(. x0{K9vklWűi 1a:% Z,a1AQ\rhd=jt8؁`@|\#yc]" 4#AQeY#v6EհHj؂a!v Ȟե/N$$@J*6K] j~.1:EJ'<a)_qؿmS[Tt yLj' V!lˉnʼ"m|1Z/10$%V/PW-"yL;T/֧3UT8 ?k+.Ò^K$u70D^ thh*y`G&pfNha1V8KoIsc:RW6&3qPLW]'*Dl0-jd-޳9-q73UeߋYmx60H پ?r6n QGdv6_km ylĀЏ޲KnZJf9CL!5KxJwߡ:'K?DKt.!ʌNy=òm9ԝl#0'b,zjLlkV1HwQ# UakZaie۪v# Ҍ C!<&Y`P5n9,-ryDcү8[4yC;5u+XNLgr?G0MDMUu0@ءbA b+9J!$v]siPxs;̼ ~ug{Fk @"W h4-M:\"x;ﳣlgoV|C<&Amuu%չka$Dts>D-erB0A>hz[sawYVU $Hϙ`REchH. U\ &-o8[S2QkJf\k[~0 z)@Aa 4Ul t RAnȿq cCnxˤ }X7(:u '` Đ haeS`sNÎ_bRHֳ;k|V^,:I2JG)Qj(٧g/jbk=O#w[A % }N*4#<0u>GVCY+ 76#UDǸ2"RFFH;RTKgY+cu*g*5]7%lH(V&T+ԙ2Oe׳騟, >73RlZubd")yʿ~{ X깣Z #Dr3Syf`[{ЦhP=j7:y31F',&}f^7*A&hO!t 8ۙ -=8`-Ib2ܣ^*'h!%4 F>\,3?[)Ң!ӟp{~=Y9| FxX8 †@ua9nOH_k~~*sdo{n1ųϹ7Vg!HapK*1o7Ėۤk CAp#k-y» Bx:pk[ <46c~WU›}%IIBLxUƈ.x:<T*)UeC#rz8 5bDI&ǛXv׽wi:u` $JPޕ*a#'5YE LIS~@/rܞS =׃v 's7K*X4l$6T73}gٗ)c鬅x@(DœA $ !Iv&D}^t7]ReLF  0)^ 0H)0`?d"%%m=N X-fK4ɷa+^zkwH;t33E2,egd *l6.\BvòRR,'YI:V{aɱJcGF~Gæ9fKdYED[LH# _O}{AQ1^^Q@a**,bDlBm$bbMF("JCco|F,Q[I0ذCX-PAшXcQ hci+% ( oijNAwE^)U;#-5m)*<!JeRQG]"P3gM\}⧶UeVbe}ut|B?@E_*i[f<.1>/-Vt_S(I-"`h$p"se,""}c]χDpT{'ouc2?HGD{{:W)B[`TtSds_*H@@MN͡!ūWǤD\+m@N{Ka]4X?6l\ Bέk$| &:y7ee86&e^U"^Skp@L:uQ El62zujYBl7M8@( *hZ81PȆvpS:CA ] E1ft9Κf:[?ѹ%dX jZu3 aY3XP=Q@eKN$D"IX13&^(+ nS(?reŒJfD&+ Lo(9kr~Zժ0.ę['LӯTy\(C?ݵC[ ޮ4x & NACZ^N:E?dԲ?cs^C/3χ,ϛ/أyX3߅~Ʌxs8ǹ%Fg)4j^ Z$Gc^t"?aNö_4uO茶̅X4sfZ o?}V۟mx߶!Lw;$ l4*uusvnZ\t[_׶Z~7W,0"hD !"SYaAh%9eH4? u=H+3}̲):(H9n)JҤYB☴;AE!D%9iX{?x 8؆lĭV]c>ٷu06 $Hw|d)X,ĉ iwjaPLTJC"su \1 8i Ԧ %AGjv?V;vTlG2&F]ܾ֯z ˎɻJ׬׻ﹲ^"lK,@gs QrOt}QhX|V3~9Il-PD#E !1OQBAI2BŖD|M$$_`'#d)"cPVL'y+&0O/fc^."uݘJ򻀷1c$h!$M0AQ`Ʊd6 (FX,HTcRLQ&()#Hh1"E"(EXϾ=W{$3lrw?cgϷ :yd 1FľVXzJp2t@CpA!Δ.V@|߹kݐn1Y=|4|k̈l1Gs^gc b,# Бra(^G-S]Ή( vo)TTQؘQ?KϗZvmGEk*2;B"y o'g⢺f=Apn\rgUPx ZRh~/;. M].WεԐnG{g/ՂAHM A?0y1zVOKiv &'ooZCgVdu,XHNwIPBHa֪{IMjer}کQiXB"ca)gKi&Y* rNhHDxٰ9o>w߾Ր"N`xS:K_}2X~\0qU]~=4|ZZ.~տޟ!0%@ ]y!x9VHc谷 owx)?sy(<41bEmC!fCWנ[ZoʣO;ӽWAna vGIF/C&,pH_R>uHK]QnSU %(K9zVŅ;J7'M\/aGItW5y=}o1S¸PcLssS*^{岈7ϓUǔ J6N$ټRc簄 N߱acYVN޻+7/[C E[J-nkj;8X>!6jA.j7ٽqwk3uwJG} ԤήPG+k4{DvHQ#hуraX@D@N_jD?κ XD6g%sV9z쇋Yjǡe^~x3_ݶWY^_%B m،keûe[].5.K.lF)߸`z$Xpx{`o0{w|z ݞ4oǽVkFYY}?/ "0ՄvWKbU\!CrjE LfS mPm!"9 Ĺ4/FdYLNC8TTRVJ5$ ڀ,RRY,GK_Lw|ƿtuӥM5T"v)if|Lq!tH҃n*931y5!AHYb ux;?#T˗  2ʲԫ6h|?J--k+* X \QE1pp28'wj=cBy!E{ZT лr“ܸT/[:3E;ye?lѤ2*yaF! >+[7OUyM4^_ KqBLJ3?o 6H*Y}nAYeN/?蔓-@~gPOduC__\VTY:7rc]h;o6_WOZ19"4\oq3'_r".5,Xi ϼ*`ѿ P4-}W },<3ǓRgDG=fu9ydDg} onQS|}VIU^VSYs0DsNqw}Z= :b8|9<0!08DS琈i^rn<1aճn" 8̐!`:j"1L 󐷹k%i9C'?c4c5e">S;7h|@*d#0`%2GfPYf¿|;Gska4'+ ÅTH8{(^#<;4?e6" 08D qhB8K 9pQj7wW?{,Ք>"a"roTc?Vk/ H0vu,0XCpLƽ78 Hło^k->9/í{Ӣ* !B*CwVl3vq'GěB@~fgf*6k"ݺKtB !{F#P|:7mo-,Q ЙzVU$ Z |w{Xx5>?ggّAlXleNU9\u">Iĭr 6#ޘjy  UmZQpie?I+˳X_l;"QC,rsgI;4ٯskSey;GA1' 3iz&͜Í,ngL~nC13ho%NwH(amFD`H> ;8 8RXFT*cGU8i_+RIqG$UkNJ?O ` ҡz?B+(\#ON@ mVv683yίGcMcG PY~:L9sxq/H]yol2TƆE ?5zm=&v q "( XͨHI&n 9Gnr:{|f 6 nك:([]Vt*.Hgogjh6:rIX" | AE1L7?tb7', t>ў{\m. DD@ٗ?۲D#_ -I\e7*BhGحa'S#DxN oĻ3D ǫDYA~J-9=Yi@@Y|n'۹,s~^X/HBOA$őBBǸoa!'uSxOY8LlAp +.+(co.ۡiy @O{Õ5$a j@tX\֠dWU댷У:1AQDEyZsX\:@LnQ,)8U%0>Z o",o,O d@)JP^)j$qNw}["lMq2 ĥC4R8-"jBpuT;yv@ģ{sNAD=keR"R`A/V!]*OrBԹ£cdu"´88_*VIT5+Z%ۑa3΢lbȡ@Of>a4& &[V7Wj,e恦8Fkr?,W}A[Le_ 0Rj/)^_ߦ.~pپn38ԏwZ俰y:8tIC|emQU\ƍxezipQq+Gڏy)YJFIn/o0!_;d-Wx^+[`s:z텑PD @8l/|wxͶxo?^oJ2`%eN ÿ7/̖嘫-HV"eqxZKPBǐjzNK!'tC9\Kbl'\;v 2(;H@'rw%  vo3OEKUe@-&PND gʙ8YD"&[Fb45,f/Il3tk9Aul}ҐcjQ,s. Ql4Hܻcv^Ў9GI%^dKtcT$Xfņl'On}1(`v=kMM!MFfҨ!3.!=!СՕJ6 _"oO3rկMBU쩍Uwt9S:J9?Ϸ&d AA 2H+J?q#0I\HЫHr\_K22QV8RbULh9ȵ_mjPx{f5Ues0U,+ ?k}8OP)M$&Mk1,@2A'(zdBB B ͯ qۺT(doG},RT*@D(!" N:0s|l%\E[N~,ŵ>1IFJHbfDŒeLׯ$XȬ1]$EٰjjdsG)n,󹙠:?gWŔQ(E"#U& V31*#AaFXXT@}BLTi3%CF[ kU8{}Xϓ/$EAWww# @$ld-﹗-.'Fs" %Q,5*72S U0YwNH~^P/. gCJH^cXK}^kBّur/`,e#_rͻXz:PV\GCBWZTjz>*{zEZO8*G8;,/ج{C˴#R}JUb6L<(qyf \)5 | (Vbe2q;7]8(us~_@ﶖ{jZ.:6mu{m`(lȿ&aRO;pu$}RqɖI$s ^Q.eٹ`)ިr- w@WSn C5As+ͭ"w66ZL/)N%^pyO)} Ȓ_]4vm vEBf^WDbDC֙Ty^s^b3Y9cÚIn]5_J+j~k-%y{FškdWƀ=Iz'Wq%e@=e!܊N ][u>K*]JV;e[$hV2RS1ٚN5e>COQbi.V"aSn엵Ak?#X^a^=gZSܟ*ݾɧHG)غu4fPsr7lXqETb|5_6AV6KAHeΎ% >PmHwO;͸s<^Mͦ {fq4Pm?"(KM-iI\vfKj#W(Q: $ 2!pDD?´8-&F[(Xɇ,Cd۶0#,*n ^k0Z E>%aktonA%@$4ZlR^ŘHi}VzerrE< |U0Tѣ1ɐAr,Qe~;-%٘5W{4Hu,/0HGi2[uX͕=b/֮%a/̱_/)+rM% jL"C(&+q $UQolBI%Y*ǝS?1#B(Amța[2 HP%g'a@7, +XZc=RP+1VSĠ D~ޥ)R!dAkߩ$NK#Ne7(C<,of%5nJN y [z5754"EcIYZf!.BNm2p0)8J#2vnQOY l"l0k1A$Nirri{ >X% kϋ7RLHfT L[5t`@PâCT1WUR.m,m^CگS(\2[#4iH::~Y;EO;8]>9VO%a(RDCmYkOz 6Qta 7ٹd̻qцvJ3;Vg'+),+h@cv("BE32L h#!a n(ȭy=װ.,5/urDKPe`ۚɘFcaa66X8q!C"=H^s!&&eMq0"Jjl(&Iɪ..2,)C:JK0Ը =q!hW-Sw6 ?0lUCǹF^&4RyAY\A`A/́)dq\-{=eVl&TSڀTJԺJd"p5ݝ0ԓfe= ieՆ VB5hMN@<[}+@0M`HiA iM2µi\Kņgd3#YGh+ B͓hd9g}/e$x\e\ԭ pkjD[i'gLFҤ!V\#t(J:D|6q̼;%Z9eq[\$C -K,c0իccIn DXXgNʉ]Fe (gfrj#[8 zܟxM:(&zC ,WO kR\MW<t,2T~MQM&vP:eApFpgJ+].2iKs~^Y]2aN>/(jɦjDJh(Vcִ+iDlYfW7CEޔɹmS"H$CpJzq<>qW;$ ض+"YO< `55t sR9kg'v .t?ATUl77ᏝRPg 5cK[>.^'!QuVv~)Jߎ'6 {r UY8iŴ6.8xweֽUKq:YP%|v?^wwFeB A"bQTXDhd7 bEU݂ sUɋ֮V>>Gw6G!h5Գ"&sw; "$"Yr7[B? G|~j (cu[={F*S m])D_`W8uRi9${9,o:TY:D\T`AqH{6BF !jHD.=!'K@N _lg >]n;sǚ-{Q?UČ{v45[X)R2^Ah:OE" ndo'do1آcKw%:P<b?BM1;T! #xER~?'l=LV'%}jPy) g%^YEvWwHtTqs_[M>{4K/ K~:]JéȄ2%COd!n`50 QL>aުy$e4p.+^I39Ba8[:Q꒴&0HWz e|Xp˹xǼEq8lH! :7)-$ tؒfO=Ann;* be:f~9@{7IG\lrZ5m@#hD4\A!t/s`\oZv収o=o40 a!7!`7 @x 'HlBTqNrCj J/26SA~ KǗ()xutH[y֐17EozTLN|qw6Uyi+0!]/W'Pſ*lsRikK/.7ju?jӦQzǼW{yiy4@ Pv &CLhv,D Luq?Dml{=>B@o;^ھ-{vG/N0ʿ?g}8)NW|z^QV41!_8#Oٌm0D%o_kLF+S1hX0?{%UZkYkkX}˺{30{/e0ZP {e+nmMzv+k`40A#4]H0%-sK>HPW?Xd"D_tn@$82+=pu?lX&݊`M̟l@$IQ$6bbF"0t.:4]f-" J(H 7% RaH ےO(8F 4] KځFJd*8T `!!f@Y gBԖWBGM0 ]|eC+IdvIhV{hLܐLz='|v:gϵ.9\ɒ`S W|p;&-{,nQda vi\h &Y;{$hE$o} @:̟.V EXV}hE'նޮG.ȩD \<ިnn`]:DZT0Si: dvEǴ=4ߎes?I>&Uװ}w@\4=vvdRt?-Hи7FY:}2$>ьUx*p6:1.0 (g$^;1w2"Jm8'q {#'+o7QE Vx`T~^6 xOu;H*F泗#ӱc,Q?9:?^˱ 9$F`m5LXߞgas DMb" ?@AZ@ я:[Rjkj0F G %Ish.m8qwwq,&HH㢈N'3qDv2ԬśeaM7;y%ݝFYN?VåM-|B\_t/ MH ] L*nio VwL 1mK+pU5Of V}2J4Q`p%zե<lT}X>TW#єvXܸֈ1}5+?rp{lfCeTݧܚ#WBoe?ȂnY/yqL@J6>9?\̋VuϬQ("D!:| ј6:QYO#OB V#!0HpZ~LigPP+JtfeE]m(>k1H}+W)Mrx\Ww.<_qZu9 8赹R$3H+`A2BnY&6gpϕsls~)V~?*jȷIAUIXV_{E0\{Շșy8,E${}՗xHc״i&4a[#y5=gE=IK6?x9p@4zZc(2y V:'sx(㷇x>=!uizn:\@>.@}aӥv,z)# sCagqwGq#fXWdeݪja Leꨚf*أDl8ObM_@kD l5,Oӗy+V屋uM] 'J*ņdJN Յy:}DcutpDKH?$;AޟE=WPBBroj\P,z4BG []^&:>ɉoy;=J،hz(quDбjyr@AocB 0ٸÜwf9U|[ye>uWO^4 o0+SQnuxd7C9 e2=R =Sа3㘈qy=&pH`45OAb4ZflpVω߲^j3ZJ##چs-:bV+6{ Wmf_aeMbH*"MzBhK}ɝƹP@Bi m?g\_mVN'ɴ{K=R'<]\_+FAm$#@Omt 5>GxbPۊ9F!fAc!VTdTITLXjYc~3?"p w9efP8@@?<[p>GFC=#! d$&ro>>=^!< @5GrkDK!/:velH)+/~ \Znӛz=od fBܷŧ`iI:ɂpZUL*jȴ oz$u27@E`! JT zz\2[ TBPB B)$k:{Mgy痍zc)¤W*"H#9~Wс\r3APiVY"K01GUsjy8(D o61S`XR3bJZ=24gmYRղ%"Ĭov4 1R$_g>r$+&͑67360Yi`!x~djVe_JH' ;!aioEh&I՞+!zu(KogvQD &)17Y@*TĆ^z9PѡGjޫɜ ~^G{k8Z Wƶ@|/&{G$ ɿ3M (8Wv-cS F@G.g;>ߣČw3d-&1,<^d jgs\pY~Tf z>9j5VAB7W͛.4{಺]8IQTMV`O :DԿTD'y-lj^qy37=gC1xσy"hpz=I3F53N!=ήUqnQ# vdB onbL$U{Gebz۴XD98I^&Hp|jRs 93UԳN>*kxG1vdn}^ 7x^@Q\}m3X@"b#!"ӑd=d NZvh[2`F;=\ LK2xMtBΜ>rn7[hP?i? .{_ y~Pp!3 =̊~NmUu3GZF|uSc\8H4N„M]B8KN=Ȑw3W?~~󽷪h[O,-fNl{hTژ>L*}*W_lƃŁ\>Eu_:P3n )^GƊӘôR%qh)H/.|, igy[imxu.!J/Nؾ8nhkiH{{sc?n% $F4BFX xi}0@Rg(Vhª8'Jg(c*\Oc<]=15NV+/^/32AÿxjRy{Ĩ,3J-z{{c:T9נ_KP{&ax\%NKù^Yqt᯻|,g3&1M؀P" Ș3H܋nϻ>:%Yy d2Q hfLc , Dؗ4Ij#ȤϢ׻;BȻnAu>O\{0Oܜ^lLU6T>{a<#W%{9[YgQdE5Bapo1%-MVX%%ZyD8HG_ {;ߙ>0ڟ*гt272wG= B^z̯֧ wNc;)32>,4vP#QZW82&09W˓_p <xΦ9jhR:欷yNtY4|lv.}.~I_Ҕs*#Ϗ$|s=c,玧,<7-!~shEBi0`ts<-k|9?2I?&W9IniE-+l19K7b\o=޾sot/R#F7Ml`jwج$)"(`[z"^݇ߙjuuPCA6I )촖}]X")Dc/k?vi(Q)sT!"djhQ`MDM\KWK\]J+_ Js87qjEwy= 0_Z[@2d@#y!}m<S _dR4`'Xj 1y|ǜfD_rcf"-@In|+R-Ai d[ +>D'⏋ȿgei!>1 9ă$B`ڟ7"PdRQ$B $,iZ!I 2104BH0A B mdjLf-+rZ[wYEճ~SQ ,s!^0ܮ4  Cؤ|s份f;u({?kAk;;9SfYYX19rӛ/ٞztϳ|1է !XƳ=b BC"&W hT2CUicMAG"LȉGHپj :juMBp4;+P v Y39ub cJA: Wd[%gFnQ"n1&+ӥь)" {q__̴?9z m/R{kYJ|[jF=\n\9w]ߏ꭪|g(:} kw[yA,; p): h^]7(2 -xhr&Oð~5)[V3\aR^tb'RodXHyCL(H H` Ǚ{x'SGbLV5iX}5/3} 4## qVOJ+jaIiX";F U՞2ﱃ?{B06#]5޶_2/Ar,! #@E0Lu$JA|uQ Ď?~m.>^je冼Xӊ$Ȗnfdc {4M:ri4>@dd5P3 2%%ȐX/ Ap e(FE?[j]8ﮥSc, Zo*y!,=眭[K,:M(L"3 XƆ9ci@{>?7ɍaP!H9{=D$cvMWgL[9;c^g;3A|ۂ?sy]MͧZ~Sn i}L}°ux6t4/%^1Q Q5]x,HٴU]w SpnN71W4,R{~.s=3A= RH`ZoϓߧcXarS^e ,޳c*tmWпo;:*)1&'D8#?`(d#w׉UE_Yf6#`~ɝg/ }㒿C}^Q/2>w$m r&G4j| Qn:0$Εj [Slފ-t̟ed̊Lpg%+'(jz7ɗ.=b6o5F(r m Y ?V){Jנ ғ g$7p/"F5 -$(Hd<$5gL^MWH 3Wꢓt:r%@…Љ .43$J 0(dkҺH"{Ap zkj}_}g3ɟ_[v#$\vmGʿ*v a2?M|IOżkgNؒ5 zi~~ rҸEܖ[+;VvٟVx5HOcs`[CLkl\~B 4N6c?uZ36ъ4d@RJ"J0@0u>]MPU` fo.c BYt)o@QoRS_ױw~õu-%~1`@ٖ&pM}y98F>><.(}lRb&\@CC i*0*2CsI#L$ }{tm[t=WBGu=ƞ([]_;9_|gzo*{MQH`0D (t@ьE0A:}>"S:vꂤ聡äE>wg2I 5? `o*.e(fnodd)/e*pMBi~=k;8wIJrqض]~驃EAc\ݢ#虇e1@Y 9l?cCC/5~>fT'8jW^ALqn{+b7LN͵'E 'Ul>yg9E%HY$xm%ifa1\WP_´>|PUbhC$o, '& ~$"dx m~dvB\D v|@BJI$x %0]+={} Œ0qt$f_AKm~M5U_ 1;'~f)lKΌyކ)nVl? ަ7l[7Q]0ޠo(^pP1#C $kUIH:,m%+ {QPD-S4LʒR[eF6qJ;ss+>jwNe JlxQdjKUJ͍V. 0C=:%zBm?vr!ؘg> |X X, A@ֆlh"sW9$q6m3w~?׿e;b=^9XzrۖdJa^Kxmso=i`*!B QL󍷭< ء_S.GP# auVI:da{8euƓiRieZ2@"~$BxIП%2N:| 5I읪@lؠ^y:o0$jŕLU~V"޿4:M T 4=>'}Q(TDӽde95S$֦P<{82Rٔ+r^~noksQƼlޫ?ʭ 7fxWQ F jGjS*HII)A42W^˾:lkaYZ1(rCU=7|3o|FU,d3!Ib / MlbᴚPխW>^(\ zz ښQ,Aշ бiIA#/ɑ'1'vYWq8o>q+P1}O:{䰒D"%TwcKSJR'zzh_tsOԡ?%US/{'4]-F9³\vO^jֱ>d̐Zm~ & J$'R.NWݫԒ=nbkTȄIV0^tUpgZ 7Yf˩Jfl1ӆC0SCd<ֶ)DC~/˫*(ʜ떶4O= ks8`V9~)@iu"S GIT<dPC8t6t LɝEdy Lw%X=Nܛ\OL eQ#Tř+f}YhgEetVтUK:=\SzzYݘ]?c/ӒoJwԙEk"`!Q_eVY/NfYB!iRgWfҊu{Q>cۯx>Wve܊f]ncB&PsZώ~ Q~׶.y<WB n^ zW k>ƪ'|FLn!V=[?""i1nJbhnqJڛг L06t81qX BQW̍,R7m)I|bV4-Ȯ76t#SOg3 ۽.IHX,"ضZmbbYdՊ,QFU([+lEVMc[Q"Ұ@@$5=00NKn kҁnvXI:2PjsY،P`$jU`0βAeȒB8]$Ov30ܑ3Znvk7x9b*]ȞQg)3O3bϭcCrfKNs2ʡ_wa#GOupJޣ(Ԑ&3{z[Bқ\k:?s(Bi-oJMttl, XK #" N>a|Y|vL͓b-e{ DO୻f56}W؈>QJ!O`Fxoz[[kj W֣ys$<($CWJ#_H%ƩcU -Aɤ`qL("%Ҥb AVЫ4?P04Rjټ!@/Ԫd~@L8P!>Et ?ID 60TQzf^xU(d ʦ! 6 Dw> _t>ب#(6 Nmr=P :0ٝ,uuw|.x))B!TliRм^"PƑEI(ȷ[QӰGGZ7~cs~sov:Qo-hC?OMf(1%e<Տ~mQpO'HWK{^xd ^WXETD1cAR`.ưq$Qb(/ed _m "JMvBBFtTP*jQjYKXyW_kk8A&<ղ#yRzqo$|=Jp>JA ŔQ#-nFˌ^G^/VBL)c![@mJ\i am3`A9{g1]>Kau 3Շ] C%*p&M6V5;LdetY:GK _݄H 㲳K6V#ש\ .'J3-$@#A*! %EBBے| $ha8?q +띔ߝ6&dN*Q4bqiT]_/u*i|[䕁\d;B,w/~ЈN&+DORiNp5EOJ56mOKoIm*HQBe@֛ɚb}\_/z?2NÒ2 6w k)='IAg$%#SpdBDpC[Z:A-\Gυ#Ԟ<^oݱ_.Dɱl{R,<vpoôLhMYV*ȏ rF 5 _l@²L2 (I9hne11I|[?+bá{}lx^ullzכ6#j0)~%F7LۍEo ?&hoBhym.&#p1U XUph+.5 ɑYOYap6n)THg {53߇D>Vq1y_Y bARS^+{ =QPjfzg8EE7Xt]-;pе\ \|?e׺l-mY _g#{w9KM'z~>oйK&&6dTܸ),§<>@wL{TV)6"*[lM|R^$VZ,GY ԧ踷ւ;Q//Ny/>siegarnaAڈ:5"DKOG0L|h%z(_Ä,f;>(y9 ~"mtA'ܪvJ֓wK}s&e¦B bEc 01qiJ_ھ:f-?NrISW SiO{SĚ˸o{+E֍?QWyn\^A eSgؽzFϰgRZ&aټicb0<*_t=nة[,裂@D!S/^&wl;pnc/D:3+}Y(Q=8Y~P}8*Wi=qzC ,~Dv͆[2Lc 8_^-ܑi~C;'EY;"3?. ־۪ACi\B&4?=_ wO>kKbNApë`PxJ=k32 K ys,́>syk[Kcrq6)+uI"ƂjPdT}{}r,s@,(ʨߩejʿc*p S1#}"v [> W{ {TH /h3ӗз]_͛"^K OO/7ziwQ\XAPz[ij/6/D?s(7ZRcb[ʙgCHHo'k^J~Km_ylaQ~2ᅔi`Ym>jj<jV={oSRS]gy 2tX$9t"$ D}*c. p׾:8 5 ߇gGPh:kPPOo6Ȑ\Mĝx|e[fҕt̫>vlש=>)o<Uc"R]^Xf:e2BDDZ-_Cy >뻁ZӸ#8E:٠vx?9_wf&a3{;gPUteo3׏ ~TwP­ئ2"`ۉ2 R':Y|zU \iZ!X(@2P5FָLUG)8 h+S㡟?,K? ?7JvO؟ݞ]k#kBDL0NnȻc't>V1"F|p^'۾. V פ}[ IrD;{]W߭25]kh9J<[3280" "hM 2DtdnD@h`3Oգ9=|,'A"` 7&򜯻z plدDhA]"+t`WHgՌs_8c#DkVt~6gˡU$7\<*ub8 KJibp]tl3 ;'YSq<"$O kR^wKw-q*y.~ׄ/}OUshoMSSFy3 VB[(~?gV)0 (lx\f~Y΀pLqy^nfAGlDB㎃kٖ-ɜÏbM7EcT"b8D >;_wt|?OZc7v?t~aeoPah-ܥJ:bP[IR;.dNKllv_ ."k_,5fZ} ZZ8}M:zS)M!|)žk٩:^GD _^cP0󋃻^`t JGnU۽"#Ȉ"TOhMC"ŏFa P"2ji(?W. 62e vI!H G 37b$ ic ̭&x ) p++[ -$/eEcO/PALlQZsmHS,m CO6ն& 1 .esR#V?k8GiN &jX̆b5^, (Lf A_!Y7 ŢBq̭ \M4ݪ!/G?MzMLB |+_J7#zȱBT^Y#1?;LPq,-ǃc S]TsQ;]\ C;}(YF˚6ݺvyU0^ bBڠ#aGQwaUY!w}kij`hqgLާg_eiH*\]9t=oKԟ:T??cC_S0:|fB,@Ջ*!2o]eiSes4h h$%|2- \R|ܺ2~" f.ĨȁiJ T+ݦ溣jB>9P$ou2eb|6~,Z==_}_ؠizg`&KlH"x_cĸ DU",u;|4}O979];dcz/+q(t>˗L|u}o'ŞGSm`.EnCu[z$lC>^{Q4d{Ґ6LX]]G42P{ chDPN}:qbse7?&o`xY\*rfᯕc?dz/tOd?/@zm,֣nIg?s}wٸk{|>؋*Ȱ glOc&p<]F qwvwoäbC#- ;˴~K/w]a;37O~%deǏAԘ>`kǭ"w̬ѳc{= עhJ;tvqЕ&~ubhd#LJ\d^PK!t%sgxgN&AaI/Pmc'[~BPsnrgeK)a 5>_x$_>YltRa6!_ܳiQ~c"I͏j$<|[n2,[}$#[qy:.Tw5cKS LPRIWI3tHXUb" v>euW?#^> Me}aQ"5wOxhnA?5d5(3T̿»# ~-A3ewPy[z9Up6aPjFR)\% VąGq4l!j@qosw?XEu߬XЄ1atkj{/ RF޳r+/S'f$39NRfV& Ŗ&2yg=] 4? ko-6sAffW9;-#[8:\q8O77Wg⾷W+Ez^ND|o?•ud۸ rYN_h3'+)}eQQ& ?kM(kI.-+/ %(i ԺېK5V Ȥ cPU):'O{g{?ӁCV6q=W3 l&| dTFbfP05jQ'0$6{X%ʒ )A7z0[%}[9'FM^+ŃLv>Df"yΕ#AN6#1|∾8:~H Qb>cۍU|Ɣ²9-Ӎl4p<Wq!MnpsB)5vĊ墿^{k:Ng7,/=-3n21 V,ҙ~sEp.];E1 TȋNuY @ u(VLx,nw-.~b\[6DA],Xse#3UIr3YLlXT 3'#Qp\*>u2Lh8SB*ryזM ]$a>94ɴ xT{zEn 7|'Aug6u(|Yr{Bay`rV`'|gMf_EAc$@JPj7)X{~V/ܗ&cπ=E DE";57NT`^O!>F?z!Gb4W0G.e/.R>3) (!  i1>Be|7|5XLT!zM9ߗ}}'Qr3*15=6!C"$f"Z\/O/~_S>n(/qBH߉XQh҃J_O _-kh_IlޝzN}ہy~E 2ab0r2ζ@b6B}OøVݦ 5(c\Ϝ' ce/]OI3S7o ⮡75k|uEǐnK~\\QTίSűk/`#;_l2DHW&vv.b$ӡ`;G(ǰ[Knje$/2'1Psf5n|sp{)GcyB( 4-R|$qj, xI.$Povjl/ݙm7yc*R@ʓ0cwyRB&{s`i oLeY"z sW2~{t//Pۜ!HB#xy)iY*iH AQF#nkmaQw9*6')xL}y׃IL.ٓ͵ \ `֠4iP:gE51j)-P~x?|EObd>Añ˾_5}MoC 72σ#[S3SPG{]cv=/iFSj'pnC4x ?tɝwO/¿#G8^1b!h-հ{?Oi Ro1U~vnГkswW (bR0 43I83'$&RGJNDEi^:O2NCiZ(4voPl@~']}>ՙ45yw\)̦l[B]ny蟔(S`@x<A4}\.B/i][1q&}X@)E-Vx8Y7̝gd$\ҜKht? D! DovL2ѐ9BuR< T{?./}IRPqל.D҃77y{K_e坦a/(,#ǂ!qG1 VyhI Yg2G/烢r#tLA^K[J_cALJ/ FOS/ @#vϷ罥MPrȐ/!#SuJ(5'~c_|K 2`!Cbҟxk_v1 VVR_R}F5Ujja;pS'[%iLS3g KbcƧ.(fjޙa. )|z N萝BLfX$NHN̰i8v3N \Gm@9Q,?Kk=39haX=0x2PΪ+ptZ- 8ՒOoB[pq&2綺G=7Ó8o8/oQri䴪xkco$hK,O»⛾VoV=߰R I3ز\v_\憇5N{Oߔցh,$hdljߐæw-X;ijJ7׃k)Uz>?یiڽ!+IClP-QJ'>`(|'lw*`SPΐf(RF tTY+E@Q:GGCM&{roiߥ ~tyn'O&}! ɢg! Qy}f.$D osf gx CŊrb5#@ ~V)$J[Gnd'bp=Ĥou۬>x.#'+J/Eř.e ~z- >Є 9C$k<\O`b7})C<:Ɯ<ٝϷpr)ਰ[J£ҹ(GqΗ8zTTk;#[[Sb9CDFHw=?=ujXZd n~Xт&'t3[Zy:* MLw)?I9Ĝ㚾ȳ1"85<>n)s\ >:7@CԎH[2iMCΥ! [zܻT" S3~xo.A6vU` vsf񬿸-Gߐ&/HQ :atC`"RH*Y=sjv{)vIkT![{0C&~wEly3FId"=%夘Ig+ܣ5cj8迻ſr}n[%<e\xY퀙 N ? p-?|tIBx\9'EqNՄYE8;˳)=ɢG7 #~g}T}{wE-DRLkeܼc>&VG:V.'(7Vѡ|^<0$N'H6V^n9^y}G0:\)~EG?ڎw7"npWfV]}[ !{X@b5F!(t^kv0{4%$ mfȏ4Z.4J怯= 90=LENaBl'?? HVϿE~f)ˇ~My֬8Ϥ崻5fYʲ)^v -KvYȪLN\@s7Pe;^]w_f͗O[;+8f!FgbnJf: b)'}APdb34W e*zPPL*ԙ}yIZGKx#,fez<%JZXoU%w` t "qҹ% 7Ffdx* 0YsקjKMar),^c2Ϩ*r+ǴP qA S}Lc IxKg?%*DaֈLy],C$R:tbs~ `AG"Ek u1i8_RD RahMo( V?ۙ:ϧVkDJS}#CZsMԲgĔy=Aڈo\r+oJORs#XVqN3x$Yz  l$&S-xëB:f ,9Sc2TE1Q~wX"h||C61ӷ?k{* L"DXk ]zǹ; ~c1 fQ82}Wd JPdj2mgi^mMd4s@7ec|ڻڼޓϔM:ʯvWdٟ7v*Aʛiy YOKLTBdGW|5@81_~xZ6*#lQRyQytMY 3BDp߇ί!?f2#}a!$J͞2j~?6gzèWsӾYs(-5 :3"2oN\eX=\}6L ^ 4jCPo)7:zQ yρ*wP0H,Y: oyؑQ*ScO彈D@CKjrM_wg%ڵf"P78v? Y"f(ʾVsOe+W\^k^k`̏Ε<37^n)C[ }zm< CS~aD G/dsMS6q?++j%UIc4_i+졐HWyL*Dsyxע%, (m uUHaū!W F ‡2t6\HE+{nWё tNdk};󿇣*OvjN$|(?Q(; ǧ3¦`qG p~}k0}8kV\I׌2./q2lzYlgG6nOٺ0du=<D2YI-\ֻK&Pʹ\*eZj[+_,ZYZj겍" b A/Ur<bSz5;ͦk=m?9JLH;0 v!n4$j^|F3XWB!,Q  н^Ɍ:U4RS$Ȑ" !h7R}+,v%T?{K{Z!Ih XC]JL"5.۝"agQS:`nF ԢFb5alS:M.ǁ,УFBVrVwM؍4S;0@x U`uЫ# 5愦w%͌b͓EI/q^rK!L*sg1hausf&M*o)Xߕz*Yu.8@T of bvY^HFIRQһ3FD#]F؉9G#Ћkck *+4Z!h `Qm]]ƻ6s_'gծO' K^ ?flY8ؒtY Q$[>r0%kZ`^'~xŕ/Q3)y\dǶ ,dLn# 2un;TN"0HMRS +9rq /@ŇI B_O"]4L.XVOB5 G4#*GgAI{  &QO$`̄*?|UnNT|S#-K9% ꘹&fݡoٿ3@GhB4pPvEdoV /dtʕACPb#tݵ&LmbP 0v<--RWsGSkO!HBB~e3S q/YV 괌m:mP P6~|tI“wM8ׁ2x5Er]$Pn__ݳmZȌ=n Xp7pDPB ao{<%ܬyh_7aSطIcPl2p R͹.Ǟ 1 mQE>>Qao""#Gfq#'xǟ%J wJbEOW{_B 8*WH![&:?/,Ov  Kg[b)~vNdG3ۿ$@@ϑVܝOzw)FSzbZ_Ioq/l[ެz::H8sY 9~t"~O靯A'2*Y,0a~J&A3iM]u&,K>ilzAj""Ew(2xFLe7_9GC6${<!FnsWtda0H ߚ`2\G0&̗ S$xJAeK2O!P79Yvq,4ܫ`ABRJgi; E)gf 4}CpF ,y3#0$JCPh?+|t-W,U*ORd*'%%+h*H>Úq]S@B,3R3fB&>+V~y;˺ǯ-ڻXL;%5qz< \< `^j]Azz}J[fU'7/ vh0٫iyG@}`]7!W$)'| k:ɋb Zt7X2elSe…}2ջHE@GӕSjg hĮ=:p/c͵Qzv~R1KB0 .X;SV^છo@AM 擼xPZ h uZ{*O93{!\Q3EF9g d#_MVZDK(Hү^Y5qڇGA}Z6w=a]P9.|_[^??(a" ji`'mWRKVa5Q;n>{zVbs=Y=}7 S~K*W=xy2Q"S|07W*S30Vԙ+BNMR~ZUfyٖjbJ)*)YyJ~H7ewiF֥#P*WqHL"E("qPr)myѴB}ĐIEE:gh/'b:K^(}K&W f5dR}5|o `ưf~愔 pع6ۿr})meZ~P]<2U&3/5-9b@D,H?Ł렧qRV_#ϩ&bc W!kyyö z|^EmRY.}A<^8IU= *\$-GLjva E妪 d?pmmpPO">u?~[E{ҫ/S@r4B'n]n9b48ΓYx/u>s dzxO=wk4eز9Pp(s4x\=M/ \1!m>)aT+__27ɯvaly(G@%L(n=&2ϞrH<*/S(3!9OMތa|5גႤÄcA2\M5ABRRe{o8ANP-,n~^P㚖JC a)uܥ)SαuB5G)cŕư!9mǗ<)PN 啜Gʂݎ2KB쾊Vw0FTv'CDs QY*#]vfZ`^[3(8T͕b^BӫT#NoU#dZNoJ{.Sk~LܔŠR2k,:TC->"{j7}7G%٪(]j,7>?o6?XYt C`/go1ixVO6Ϛtu<>ɕ[cy"C.ka6"yx<=D7z)[lڇT0(m@`iGD !{%ni!"D`@ ;_%0`AlJpI,T5LﳄL'A̦_ޛvkc"OT/w Ӛ,PM굘>in1P#Or~U?߮fe~>XK cYe>$=QbiոtU(-Qq4Ʈ| >N*-+Q20{,0WT7 @lLY*hd|J|Säa^P} >#-<8ūW9ϓ9gigXcF 9Sxse.pVd=NԼvהF 0Ыjn,4j1cpL܎dF1XNo.nA%r9'oNMm` Nm8Zo}epF@NX*A`h0)E ֭2{I=g/Xe5cUo['a[`HgDc9bE5t쨕}r\{qob _Q(^'l0~|RQ^z_U#zj>JJ-uV\Yd)7Pa /qklMYYbJ0 d RV]b د|U䃯}-(1+hN/p,bmR 3 !rYFR@ӭdFk,a:CXJb^8d7E"CFTI5ed*>{o_Nm{AVww]KpՏhHRk>!{&;?k^P[/[/D̪A>+DQc0`r71n k{ol:TJWֺ& dU Y%!Xt5^T|WOU&P9 I0?FJ)fX @nVi#ٛU86e?n8AAB(B̟dLt$`J9hW޻H=l3C"Hc"PɢȻlgBl 8 jeih8#!R~QFE{@GGXٚ۷ޡCEDk"|*`+ $@LOX @A|.]P3'ݡBPtHgZt?!I)xW;lBQk{eOGZy>nMRs}!~? D`ާz>4!5N> %+i}_ƚd1W$Οus~)]qv: Tw4C{P{Nßʯb T)e ً=@l麮ԥazΨ$$V#A"{XDŪ f+!Pլ$ R654D4"idMe ,}>da=g?<(J`}{Y7EW~z&VBV\ř* Yؠ`{R5\h9.}k+*<#A P'qX; #zڃ+J8(c {ͱ6(}ƊDnWH+Eal)Izd#}Ŭ~ҏHp6H0I7L/{He%G[TY  "BPA$p&C*IPKh6SHC2c4& YI((@D DId+]F]. \[:NP]\^uתv{(5TFמXn†HPJȫXw6 NbPXk ,j]B{!nc/W-M[`L |Ef2pݤK:m'7Ow_q׫H`X]{ّeBjkm`.$]DoSz6S~O:CPoJ;un/8|r~fl/AN#8;|fT0m]tgwf$`vDs2ad Shu\j 1`Qvno!W [y `h-< FQZ,q7#PhA2K#!5EH,g`cuTD0c95UTT%,HEDLAruRk(cX~F(Fa V.7qUn rJ"O= f/a4mXءRLE}Z'Cq10HYL0.É}K@ ^A1YE1IES9#J&#Jy@UrХ+Al$]xa\yi'C%7…"Aˡӊ@cad] ӀSocc08խy,dHP7%A}x$ JsIvR` j{ b2@Ʒ$E޹];jkjZ 4e` 3 u<Ilԗ#;,D:]i`Q^ދagaY6n5DW <,G&(eYm'%65v3 մM-vV %`Hhj;mdaUsUI F+}b3R|NA{ԲQ PaPA; d+(0QNH p3ȁ䠄 oѶתemT7v4όҨ&Y3|fYaޛx2X[yCH9rx""2Z+Jl!Rt<@ 0&xb噮7(z љb ;#r:ˆU] iVMMg,E]d) ;vm9O/WNS |!~[^!bDH pVeP`675ep0N96w&_t$q]m*?ǧb(UB= ~>h^{ۘ@aLxs*Pa][BtynO{)e%5-2Y~QwD/nLkRR{KȈ"B"@4 MvML=`7`ؔ>ܑbWH(H i*]/LˁF<Cad8{$A ׆6YN d=h<'TS"cN"J%P3Ad4 U<-:ld 7:a{NRy}N)J|_c,Z"Û>zW\~M$ͣcGαYu}>"3ב aĵp8|>t)}vvwq?J)迓8/N̰"*2=297vNÛB$@1 BDo!xDXtZuA|8 ?1h8W3Q PuKصI} _ ߴǍ .o?dWt74w~VV>%?a~:{x:""m6EXLZ~6o^(0: cEe S K/TBLvf1B0I^DN9RuT,ʬʳ?*ʔfCҀ#AJYҞ6&pEYf,'i}")Ӷ-F:m+E+YsJ Ua}m4ӄ1G53%<.ϧUerX+Z?Cل{3;ծSڴs˂>aZgYB36m,1xk$G}ٓ*,V∫=$۳kI/GJvzgfA*gr=<:ܖNYzǺ [ O2EZp|9T9ZYSUNuT;&T DRBA:b; #i*mѥ {KN6>rQ+dDFTʨ}Z u6ĚExΌ%Y>ksBץ82N n$h:/&{gnz6bb2tT|F.N ךy됯e.ѕY JV[t ܼ9M9$j&hмj~rcm)d!CFKg1`Yj:32mZy6M.1-UܥIr,~p 5Ɠ[ǻmPQF20e>gއf8W Ix(Dt5蔣@Th QOG?Ε-x ?}aQ{(&E,Fdyxʃg}`/kWOŢ0)7FʕyegߣX}zeh@g$ v40}:m~&*>:d'8 .ð5:mtFH;~*'w$@E{)+6m<5dl#l?EHϨЛ>Q],inq_p<1YmW[q[RKu|ڥcV~w?J; uJ{ΖFշSS'61l)lίvgø Gһstv}$d4;T#@z@ae|C+_;wcGhxH' S;q@` eܦ6r/Ԣإ`sب"*V.XoE )cW T\Qfd- XZ,`\?m׬ui{oq.I:tЀiw\Bs}#߷g{Ƣ-n5-#n$ _=,,Fi96?s&@7wNU(`-cK0 #sAha>Wkh{>ԎVc;PcyW=>NQP)vlj[Ic6l} [=pZ5hhIVnZNHB{ޗw8j_Ux{]did pqf \hOo.9L%_^ 'z{^ 4 H#sD']P2{Vɬ2X'4fzY_ak ҎmkU'HiM&Z8QM5Vp9W i$9 Q1lUq5sK">SmsrP2ɇ ۊf;1T['~ut]&J] M\y_hpRDAkx60cytvۄ+I v<șg Ԫ5Tێ'}SuK=EƢNAv'TXc+!G`$lUCEɑp٬9&PJ_ Vk{鞲",tZ?hx U2A@ 8tAݡ<B LjJڳH~h}sݧ]*T٠.}Ou3 2P΍Dseɋo^MxWEBj%g;q\ͦGH4'뀫阦)]O)+VW~Σdd?mU7n]!:;,{xV]PG L+B}Sntd"?p}| JN] <DjsL<€aD"d@YeRQ4Un^{6 שd"P6=lqNtifPos\jiAT|`Xb, % B㠅!Znz#د@vjâ s 18Ǐ 癜pP LU\DczM,ω~lȅ_]XCrSyc>AQ0)*YAgP֖JgwO :[V oFoh`@+UMk[Ahf:= &0H-K0`B.*4 lvo**x3phJCuQ[lDj ~Lz"݂ $fbW%"lZ'"OS贚2k~_ L]EM=LUZX"lbK.kn(+H,=>T$^v,|Qh#߬lC d:8{S2LcS(E0! R {{p!HܦmzC-ySkɅ iKr˿ѳt}|O/>[C_I]#'-NäR1n`$/(aN"Bwc$0hkLM?q7w sv R ys+@^bϾHeҹMZ-*O'zb~*D?7()LT|*mFsNZ xY%5JV#Yk B*a (bsBK>0%b6qaKjMh"t1ILPZ[(19QF66SKeKoh$ZEBb!`][+YWya7 i5$d_:F9ꉼV h^UAm盹4;*-M@ybaD^DԌ7ɂ+ud98D Ms(e96 gfq9r'z'䌓vh-l52x2h{RlbScu \A$ptdط#8˞c$әiRۗ<:: W甕H]`0#2AhͱC4\]SD) W7WQdUa.-KIb*eNBaX(7w 'Mr7z͞g8)_S[&ϽC"/vh,gdPOgT$als}pS063]0׫V/5сsc',|"bk% DT0Wh&׼Y -<:TSE(bdXxmeG lr]Z~# \$ڳKV@Q 5#mZZ$&և^gkI"%\>ЀdM@q<@6J0 `3 [ruJ4nD2#-:%2KΘRDq]5=0%] {lIA9 c {Ci]@X qD%gB3pD6n_r]8β,_rR.1n3;>C@ .],JR:v6\0H!Mע e_h r}cF;N͔4 IDTkH 5'f"52hf.}SޕrJB!XZ T{Q(TkoV-kM rrt%Vr jm],h\P(1B|ٞ &DZM#Ļ:3_뱵B,L$Rt3KnsdI3IKX/ D E2} 貁{O"n#G;qVB(,юQ6|o6ג2G#X-yBD茀(P9VNwƁ9'1Q|i\#XYr,7K0avġJ}?0 37A,LAزZ&;oc_KÓ1?Ⱥ!xJ>Vb\B.!DCWsm/7J"H2<`e0$!n0]ޜ[tppL'r"H!̣BKࠆOie:-9b?ǑGlшrqUC➨7bXޠ HQ'OlqQsA +"(mD끯 I.!zp: 6w]S<t2Ѐz &Xd s@QQ?c7_V 91V pGUU2JgY5~Y]e'Uߪ]̈n|{ww%)lUo?3pqV5~0߱>.pM'Mux*gÆ:6Dۥ_Ulנq^`eSLiga 9v*KY2z4'`{ɃXA'X*7YGyQX+#~9ET#kFبb`l:Q~uM:O|=P;6!周D4RƷ{톫Aqt=QFdȲ&ٗ+<xVVU#|iP_#Y'jZ sMhS0t,dHFΪ,c+/ IL4(LL<Wx6Vp!3%I A)bdfM"EVaBb΢M$%,E+R`,w7X&&#P)XMEJ8TД l73,sAΟB՚ꁒgO֝Sj7aFFYԙ8R!)4:IaXTUjM N0"sZ'dIxT(@LyF +(y1yAQPpVѳuEb[d6 -@Ùz0Hnu4&B(KRcoP^-`LG"hx̝*lR)I"RD% (Uޤ ]BomzS%B2doem2TdD(3*C+&%x $f2aj23 ؋"3-pq)&Q{hdeh7VD9*Sd%SnP3"B%$AJ@JұJMn)K@Am'68l4Yc.ΖWy ^eTnEIVsV&UZm6#DE MdjX_K( (H`4AE!H%D RE`4rk!iC[+l+CC-UGAA,wv4bhEz!QrW%Y2rf,ғfÕ* ~1kԘ`I%7+K/guiqZ8S-9?.)gO)XvmqUmpZ˽WKRqScGA1:uT\RT=B8gÑ͘ sket>dO_zn =MN[c~ĜW@a nO l0zE: uy6B!XCzf\%mX 5[Gt.Z[I`SS8h2g [e=54/TtYW:lqNvv>#58c[.r䧷)lV:]ko`L Dl|7ffoT\D@ ^M:R E lv폐ĊA +ֵ>kMD|U;3@5y7p-̮ZZ6q4RDIaeI%-ߟwvQuVL"yVuhgK h E**MGLz4R}[SRLWexk]tz\)r/OEb@N&^5Ŭ46yݶ@UlK2dZPl<( 6S8ຫĺ#9Z] q lǦ‡i\b`Xw@𣽅AIL<&$:[*˯oĶAຄ48I{;ߜq3kZ))Ej@gE5%{MyAf4hX" #GfѤIxQRh< v'Qq/pE Fj#GD?qnL'6pN \,n20>{|pD( 2H ;kV=OۍOVKKʼnF@>t ۺ+{fq1elu|>FZ2r|yR3W3J7<4ӷ+}I<Ǘ3i4N1H}<"_p}!2*7'Β]q }#U|RY#?Yt,T[;]7{:kw$Nx[ۭhh|1͓o+w6뜸t򽛻6av cA9U**;&Fj/?/(|sapLz2an:꼛H}պ_{ (̡e\ yD=޺ }v[ߧTuϙ4FI{u>a]s?ʋL7VҏNѠ1gyphM~{I|ۺ`-KG#kp/㢺kpط<3d6:_][jmSTȯGwM{U}t8>WQy~>Oe+`vW)Ts߰[C[EGhirwɞADmzeMrw%׮7>uMF<<>?bw;ccG}Z*p-S;q>KE7Jr8 N pe__\gD,v޸.*o* )wk{ /fJ+7jUP 1\k;uj4 UzȢ3PfG ml k+T[?KBu.ex^;]&f"mrMFXS,ij ZJ A %ᷰ ],Y}Ń5Ef:sHj8~ L1Ze;Fke]yY }Q2O.EuM ӏϷr>'Ѓ i9;c-od~.SL۟*WOrE 5I_PVwO QN_w\N8e%\xuoj"FWVp'&Ltln^\"Y lu fԝ?qu,Mr6M=<:ݾGXF/-$p ˟&jF~7h)||9'L5*h}+&X!CÈ8nYaQ)<<8oc^Ckn $_xoN/iEf:JqO4 H0qQvŽ  2uȫ&6:TEs0wjRɥ% 5wDҏs|[HMwCR>ȹ[sL4aڏwͼ7#?m_uMͪD EY ;KVSdN= 6YZZI/RԪFnSSɩ[5 b'yjdNŶ/NAlPoevpv*ze7+C'+$uMDTP2ݴeH >]e!Uv WײwhzܽHZ4xfbRl jt)QAN"9$ّ {;+ eVěRo,H5jHV>wA.޺>Ks$-vF(#J! rA/n%&3mkJEɘޑn%A 0T-\rj9388 tpߐ<(7F[`R-MYn[D!SH`v6= 'OnubUxe>7ݻ͏%H]oY`j[ךA VX8GZJ4s2xRl꜓h\S攴~Ld 1[L ʧMR}Ms3m_E f믶!a\}b?g?/봡׽hwf2jX>X+uu}h=S~E?84y cAm33mCpKANezdf cwAT`uJ-Q[L̈~-Q8WTG,{@?s܇/?~Uel1oG9HeTbTڡ f|琟<҈MQ#lr^tZ@z!h;::٣PŃl[#l3/Mf)j_#krcn`kd4(C.ϩ\Q"`݄Snn\mR,t/켪6*T3B=-esĽ!jC'@Y(Pi~ǒ!ysj٦DUՠo7XXZhݍ.5!$,R@2J.Ym'@}5x[sq‰=LtW%U1tJ1b>/pxkJTr!2QOSMxK^|5k~-;6p5ʢop`!2Dd[6SZ%)HvX>  V{h`eo>h{*k#wk#o-n]y|ƴ%LqJF8Yc}mQ7>c7?̃Qh>h>i+-c(*ܩ^ЫWn#ꏡRol֕s677:h oG+4b;;^je.lrh1onQ2`SRj~œU͒+QtQ#:!!54U~ȷs@]4­p=bdgǃޝJLsO{ޕET> W ]m[oΆ)܂W,zQ3zpo$교*+U ('zk\ɂ}ѕLL9;uhyqDs=&6V4k]f/<>蕔;ux>Kd`ќ>X|6crZtw> [YW5oweϗ78: vWwO2y7zQ]`ƻ6 lKfQ?zv>Qy<|1&.Uֳ_YxG3XnóTioYyO:-]ʅp}_ɹ|Vq^8]\Vnj9|un ׇoLuc'\ݻGM,>|"ݩe{YL]e~P.['3q|ǧ{GrGeƕuY4S.}ah54OҨ>!<X 鈈1q #K ֮_UR7o:'gלdM;VW-3 uΗ~V m'#EG\񱞇_w%[ !A-:Wͅ.8W{e35a8 = ]Rt:;CM\b]Qd?l{#wsՁ@Gvđ}t%@F4(z%wԷiBQw#J%OcbjidOMa_ |G;Ϊ]) '^Y$GA1E'P$cDC  (†@c}3Cse)\][u<^_±mVM 9NФ@(mcįHwspuyܷuh:~[O#y9d7ݦ8g9scCe*E2xN,\}!5q5մ\FW-d^k4s/>Bzf$Tc<)M13~%WXFڝU(ޯR۶%82jn?Fkt-<R0%@ lA!(Mg_WYHиe=ޯ$ΏI{sdA=W&ȃK 7?x@)1Hϑ׿D[Xp_&]*%4XSfx-+;d%NAXqQvuܞr{kV[ڃ7vWUtY#]yzf1b3NWSgh98:%&ψbc6ofB9bQ9#GKrB+::}_UP f65vcwh>$Q lnUi=c5I|וA~r9VXCǞJoi g;%-&Ž K@$"i9ƏaN_܏԰nV@b>Ox>4!(0.e_J_59#JfWUDYTS}0Nz?v_pٴVnοq_2?'Xӽv}*mQ FgbPy3fB<4%{rݵ4pvO :9g(|^FJy7wҫʧ&(n]cw΋+ QiFoJl[G;9oSAhIR7S 0pY4|;BHݗ2\e$\B?G#⮛Ż|/M8'ǐ+`o?H$5hIũΛ>u^_Vtڊ&p8 AE/y)W類Ss;s3p^lV'm"ܞO?/ }- ']ݖxD/O+Q>=NWe|gûeS>LW袪;" ~a4&n/;7)KթxKUiyм<&'%mŜC^&õ?Z~zu4ԇNfVێ|}mk/1.[x7ƎqM!ۓEKb@{0SpoUTo5=™v~T~#?uXS͖E>cj^Up_&(zyd ?^$![gH6VTeq/ԗA'bt,m>FU & 6=Rzaܭxrz܋'~~~&U=E?˚T#knM+쵼$U~FW&CCEgUXRl E| [Ͻ\Mf"xFeI/shULOood օQ*7X2!"\7cU>$wx3 w\bjZ!\:qq}x:E,wɞ6ω_^F>q{k]1@M 1r* Y֚Ӵij2a޶TBoV-Cjp*: e۶<:PfZ _:YĸD 'n&J}NWYyŰbľ§OԆEWvߏ. wɷ"J=%*SP,EaDnΈf|,~ᘯ>jyoY.I .DoM0v&sYֲc={(YJ4Ŋδˣhia"")Oeѷ4>5Z3Ϭz׬Pu\]Kj=(^;´-,JT/cXh_R=(_(hDu"2~~k?2K~Ot$>^@WۥB>~̦In$a$/ܾzJF(zuPa{Xzeaٹ虝pEYo>Cs$$1 5j6͕ZmF(JXU(ͪ1m_9):߀$wG?j}@Yf9usud|_eDsYD]ן FW\NR$tJtn}o[yé4>Cܺ)fUU 2$(誩I t;kʆ7pjP{lln28wg5Xe&MMC"a, QMҦIdF@BЈ "37}`FQ "R a?ɵ}7S4fJNWMBH+ t*dvBjHbֈ&MF˔*yFlfe)]O]J鍜ee4dH*A!'O8*2 krST6Ho#+dIA" PYFnII,J\%+ɔu]v8Jp:fW5\" g.E96{9NƗZK&+kjlV_˛ 3.8ΘċQ35qF,hN!*TSEè1m^86HD=P` DF!HbsUJ1`vPJ D 7:h"0 -yn@p37;}gX@Ys⺪GX0G ԹfLZR|f@G[3Iy 'W!aZm0sK1RC%ʸwdh3&Mb;2X%NSrvnʲV1\ s&l0NM'b 6B<2q( "ZCq`ڦt~E}"I8ހ\ \6lK|U6 v5ZEj+'.کg. ۊʴYwEוjQ!iW*EVl V&ԈPs(h\Fjz^B`ET1'jEªhi"RDL*Er|Š!N10A$:o݂Nݍ!ddvޕ{FEYI7b Qc++[d7 06K Nr ZJq J&SaB[ pė_j7lsN(Dԑސb[diztML s [VR5iP95s_ӗt/^3IZ:];D4̿l7̀cf KlG'jL؆G,;0Q3 ^I1%M$m)?Wu) n6ÐV҆O^B5;DL'[-{H0q:0WAcb 1K)61*rE#REP@rٖ9o^ng:W P;}l9WJQ -t}UIߐ M}+ M)̋g|MN!yt/#Ra}L{AReޢFs5K+uqVXLw]zXui&dFNBtڪg ;/MUz5;P1[V,RQV)(hJ"D)N{H2|x]lܨR!^Q{- fu* jd/$BJ]ݎSWƤ*yV"i.*`I.бBt]{GJXʖ"Q5ZZnJ@3DSܲU$˦ɑb1x `((Y乭G0nҪ xuT"$Im$CF*N Tm1H&އ#ua}geh4mzʸ`YjSD~9 Hܣv Ms6BU랶]=뛲U :hDI(!2Ҩ0qLɳmR!c2,pB]:p |bH(˪e·tW9S|D}>3$m>=yLOe='Q 6PVlhIJf@.[`Av H-yvgܤ9z<s`j벜LfŅzW[iQjG4p3ԓr@ɱXJy+A62 LK1RMBK%BEmQc/  &NƲjB4K΂m'cH`4}GcNzf8/UB4I() zpMqs%XٵÖsNx]M,7C3"a-tkFdr.bti"RVBeM'Tͻ42>*E a >rcG\#ϐ+|RbRIv59mcOQ+33w/:Gܿ/ EAUr"D# ]HBŽh#5,3W/yuBjڥUÈd 5H]ic{ 2N*Pg_$:Κ'js䮇jExL|$jP/^30ܮMiS2lżv4 EɾMgy"D#d˟Ÿ́?~9УEg BߖE)%Ҝ$es5L|t1?J22F4ʡ1 &d)d fQJgtRhv#qES̲II14$۩ yEn*(5(YLɉ٪}( WڀPOEmŊC\L vKhˑ:|N; w}Ǡ$bēNKws Nq\$a2uI9'X}]i~Ąs#SYp6וqt\@9+9F-dke9 <3zN0`tԥgzRƒ&@H H&-Own|2J|z73w=Nz\枭 ' }tgߥVԭ5|!po)qi$e9 ++>f2=J -gzMޟRp"^u\y*Q7=XEЍQ4[8J"$gy|d%b45ǔoˮv3.|˹]a<2Q27s㔁=jYf:f\nN@!֊nN vНĥQ|6X qst*@!8pX=t}F_J2__~~\ 1+ӯr>ɹ5W 0ѧKM8F#<'e: 2/!s>Kו`4܇ ΂f) "H zVؗ~C؆9p ]A[=?S^sd=UQ) Vx0J%S/zfm[5HvM?pbGLHL$YS bId{]F/N_mi]}AQYDz 9kCܲε(XNY4mhxF;dSB^_Wpw `5! xaHp h Gpj[kq +}Tu6pt8BAV9嚴(|߷xCubeaЄ|eUǬ}5\l iHbP60M6<AE yYlOov*7K OXQ>?*zPaP "xq4(nN([\(9ϓ3oDBpRK'Hhk ;TRvtveV 9$x?7/~g&k*d <7SS k!$փ#}vsG}[Ȍ_7 +k{_L[ a&uͶwi{IF7ĕɮ[ݾo % kt0y)e`?Ɣll@YЖNKuqע#j:q:4Z=Dht858lsMy# l0^} 9u50gak pKgP5{8GӏLe%|.Իb'b֐Oj _D2% d{P[l[7\:wǽn(w;`nGԒ($z5 YӸvWU^ǮXPC!H =頡*ꪕAH ,=kMlnMho3:5.A$t2h:G@B@<{٧kr!׳W#M@>t.k}=zt޽=ӻm̦kns>=9q{Ͻ|u3}w޽=}}tv{;};5O66w|Ϡ/n]/cT (iP`]@bd@MDDUl5PlkH HLATk 43{8jrU" Plqϥ](OJ9clѬq;}c]c={iU d=NϷi".}m>H9V>|4 xn,ހucǷx-mb9/mV0 q3;{}_ݳ gTQ*sݮIm&^NMl{Ӭ딫BQ72(l:Ш]ۯ={wk_ZN8t:k-3Y@OC:.r+YJ,< {{{[0cjѕpWS|/Q.Mw1wv<D(P A[[[vTs;j4UM^M46{׹(m*zznr^v<<0d}S\-kaWZ4Э Ag}2j(EC tEo{T‡FtU`^Mp[;4Zx$Mvx r2Tkwxյx{{'w,{6xw޽7wfG@h.g۽z6y]_lS/}Fmh缎н_7,y:u:%\)ӆwXHDwvVӧ,z*P<` ܢW jՕ[,XƑ#|{-mq^˜HN Igm7YUe%9n!tD7?cpV@zg[yȈM4_^=^[8؞epnvWWy Ih}^c8Bٝ: "cӾ]´,!ͷ?+dEp2Uj&ݹ>h&uqCM+qMOç {z͐'Fu}^:B5yUo g-" /,.7mjP.Keb1rJHe};NTb1Em5}M,*UEv0f/.~_]|{k\2SFVH9AQ@+OS~-F'ʺp*tJtpwŧi ph.Wh BXO?DGJ1oݤID=-cv^bP! T0r[.ؽskoF;f$'".9˪@NOHm-i? uz0()_z) oByv'Pkԭ j9ʴ3 7F DaDJ,c,619g暜nSx*N_Wk0Ru9%b"I|&68 #V) 1Ҩ)(Cpun8& *Ն{j0쉣C"pD4c A. QY-Yt_9XVݙ>MB%$@ $E``;\.jّ秵ҥ >O}p@m\ 8zX}sr6qL.R`m5a&adn7c3;R.5R5=t$S֡|-0NRۭ ˆvQ'mx!рq@@NrEQ L84(frw^$dbBE+8mtJͪm Zn[Tw9vϳSĭ=zRA4$ _x9ŒCO &|۶VKg>*~Vg޵.OGċf]lBuq$o |=^Ņ'q Iv \:"J!/$XS F3/[9Z+d{5H^uvٌFyHsy0r(qƞbɵK7E#"OY-51&]~ ub[p8Y֒i}<Xsթ^`x3J62ԀpD,ʉy@xWg^,37бnŢV{v&0#=_^:6դ\gWQM]I; $P00FJ„|p:#(*[Bl_cǪMb{پ7 eg'.#/ c1{vqt>nA)춗3XH:&^ S8bEX`!9u@4 @$ o,/BثYu '=FyAX2GoN矆Î3 ٮ4aeԝeB޲r/*^y_Fx2kM\f[V XėqbE0S2gī՘H|".J=vБ24 -٦4ɒgɹZQ&V%:لӘx:Im1qd-pYֽǝ%sLq}0mυ}E#ZNq6j z$b=$y'o-8O8i1 6 GNMU 1ukBZ^%tHq+:ՍG7y#W\L)DDEy EFc@"< |T^y=k gx#hPԢY,.4`g>槢QꝜHGj0u;l: 9f'BE^opQJw~N+{ 6PaHJ)̲`cL$0LD|ދ6tpϚV2. 5xo>/[wTgsP߆vZ+^)k !X\Zj]"-Z׊r{w>FN@k4A(Ĕ) HQ1<y+>A|3Am_,>$Q1 zd<)=y`4}Ip '`71bxEoh2,Pj V8˚=ɂ5L*/ZqB"S}&U ^}%iԘ#9tr tΊu|?OGUz:\־]4Zf'js )|ǑTᦖhoFgpAo(!C)Ʀ/Lv] w,}{:^s`uV:ETj\[[Ӕ9Nb#vqn wR_)D/ԁ*u##*JAx8ɏxh_z|)?,K1D DPr@[8[@l^tD9߅vт@%I2ϕ%lz9guL9Wbx׽ k^^ٲ]S6yཧZjXhJ_^BU j$1~ 7uO!p~"[ByB3J܃^ՀQUx01U6: U'?!/T`Kp+Yja3^ vLA3o0ҳ#L-gRJ"%1v۽Z"P});n@yv+ bcy:;ʅ 6e[Xl!.GAAe{XS]!/y>J*uNcwcQ2+mx¼ҾjQU#Gˁ}8,]Wf^91=I3g{Mo/=#Ss OOFhx; P"@Q32RH!preZ1ș(v]RThVMeX_]~}uOM^q 2";S8X#P󕤈LkXz )">B6J`# -rr0$ж1#vӗ T# &LN$p7+q$0`QKP$:wf`TttI+~#jbo8lg !!zR1 4DR>`adеFIHR@iXoYc#/4WXOH{y:=j6ە.ggm iIk_MKXyRSiGbɯ'b_y] y|$'zL81s8١妪h9G*;&:89<ѳ>?)Q[7p1< _3`,V$X*POs /S:Ye1jT5ԖuoPpMެ0'/՚p|dCr6G|w3ۏޚ<=6էՌ=%`2tGfAw}T >C% ~BD4Q<xJ7@;;-01dZt{MWzŝ}vi̷q'={{9ߺwS"fN`~zPGk]5gҠGjfGAڙ4t!s.5lVTz~μX$Z_CRE*ϲ:h헷ѥRnV]*W8Pq)NE/uKVCoxSПlKݨ{m}Nm>o;m?G! (eU [W%}=\`Get![}.􋍪4w-*j7b`$ʬb 4!ikO{R*SPYZHwoc7S8?G<1in=U(,2)I]WG_N3yj]}ҡXwfJUЙ贎+=!@eH7s&.UyoPHlj?ѷuXQX1*Ů 4G^~~6 ԯ;J,U'n0>4F,1p13 g?U$=e٘4-0Ʌ{K{ CP} gW年c>hgWHOIM@uQ/^?& ol1"737d̹UrZ s *~(h<=fNd/^#'6M^;qju,|u%m--+ӪX LMtY)Ƣ. !sC3MuO3kp]}) bI\p5dv1#_@j(5o}?_Ѯhgh

?m,mm[8L'^V- iWo&iivgettOMm8-XMl}? =4F;r:s$Lb^#=&\7[ݜoXL,3;I>*AIjYf(Tlڄ˲7>o.̉|i%_1{*kvcc}>K I{-_ti)qxPRMpA 0Jf2#L[2փK;9&t׎CvyhKk`1+n9{#`T02i V(,R 2ḧ9#k d `$jm#ݱPF}h%}HEpG&jd 9Z CDDb"L&ScS?;-ܱ]5*\uwMsW`-A2gr}"v.FSAK"=f~q>E' =G!3{ 4 Lۼ bAT˗9g&12ԗI B$KKf02IAfdσLU4mZ$cJ7|t(uƒK{pG \ܜ}\vשq~<mSJMIJQX$K$I]r*Z> `h #!w~U]T.%Os]~9Fv.5;&CV՗-2gyl%ư Nd5K)0)WEzZF c+#@zQF.NRF ǔ-[ ~jg!a@:71͐;gcRݡIljV-ɿL%F՚jJU=m@ ܕ-{3^;ɨil"|JTB1 y$9OcMfÑ] MuGپw?d΂VOڀy)1MX,eYyPݯwLg ]ƏH[@?> }S05_vV)փ ѓ4y=V?xCIPX3 m.+22Vd̄RlV;nYɳt{.҂=5㝹h)F)O_˘o=мI/њ>[|7fL͸o]#.qzIэs=/'5_ϲ'k_dotYKLs^١޸C܈G콽v[[{@q^7‚(tcԮ/$'6}!c 3&vLIFpϤm_SRmOk>__։߶FDͲ SRVl]^[YLK]ɮz^Md+G۵{r6zkҿ|R=ZHu޽Kc\I{2yQ#vV 3%; yzWz'^ Ә7Eܒ0YFM4F ڲ`,$9N`fZTNAWÄ-@?hެ;z r0\:mmG$ݺ*Z}T,Ҡ]IH1ȈQN]KyS7/jXRzi÷d43`w|8=@mɆbj * le#ܚ.n"f4rՐEe7sJLW*?L"" Dĸw!ƻ%XGt2VRRLeEeŨ7VIqQ[#cL۬1=e΁4s'4p^,hCȌ~FҪH bv}nW5 D7Jڻa^A0DU"Rd1ĺ'ʢdtKMįyRX/fE(% 2*2CJh`$ nZ23T{<(h6^4tܥJ09P5i,ٯ*x!P? fR1|ڔC,.b4f ZZI2ZZq}kL!r9ߊ }˙)0&.:*K2] $Ij`Apu"hI2sQExzS 'zwaUN-#ܧ۬egvQNI{A#?Ju96iI~x%x,Q?cDևj୆  6ec V'Rmug!~s/Ih!N d9ˌ-@dWaλ0ņ?zVXt@k|ˉݰF$L7Dwa&D}|s!'.X%1 ;V)Em͛g_Ϻ-X6&֡"'ra$gÒ@ك"`=נCϋKϸ=߮*$K0c ge6-s:EŔ^*U$-!@?/E# Ta&#j(B@q)[;w L]۰$T2 AY 6ZMP¸]u0~LtzՐ00b%jЊj 1ACIdX3J ,#6KY^!enkY{BmO%(I`,pˍ4zvq'99HsEJ3f̫N'-4jɅ\&EEI̍"bp6&ta`Se{E^KVֵ&1wbHr\Ac\2I6&(jflvՖ'rLDDDbܙ`i\Hzw[Nd^dY%"əkedk̿9H)eA]ёc@wp%ɲ&dYYlU3Mπ@Jj8-,1NAHlAbwD4fKF:iI=,l':b4>v$FɅ1E:N('mㆷE*rv2p,ie(LFd/Zd?to SeQ1WV˩9n~?S[Srao(*̚3,.*~X@";@`&0&#5aO{hnuk݆g G`_@bb˄EfʚS\1Fߠ` 6=uP:LG?&x,9`!=xG V!wz7J.[G(hj`=Ps 4׋3&TmnK$;–eJaĝ|&zfkNFL/Sx!duJ7^$V'bn YwơX"~DPi,bigPg\3=w^Բbh#Th(RBQPj-~aM jo˓Ԁ|(b! / Yډ[5FEÑydX5&îPA1I-Gu^ø˲l%F]{4CE鏷>;S1_6Km~.6m>zDx8_5bE5{%6-&{wIVm2pF3`[хӎe~}nCAcA8s*~n8!ڤLus][ӱ`2anǩqcoSq~=jۋ.e>?UCIJmV 0nD 5˷~5gqNk͘;؉Fpw<^\%wpuaJ݇QO +UېlS*`/詌dA0Y'MM`̐b:[F)2`=o8Qhʛ RI2 `A3DJ*b~-4AmԚLWU$j 47]& SbiB>Zqo f ᅑna\8j|GVٜh j +r Gm\ra%rwGa 8f`3 0JK 2-bֆvMovM>~0D+uZR.Є:ye NH̃)`"L=oqv MzW+;=%(J@2@ܑ%02} @ Q` "jf=7.d$[ &ܚ."Q|K`ŒC_ Ո?v@EjJ>e)yD!ƭ {,#pVAډ<3!, RPʼP3'45tSh-x~02qHf4s3) c&4&`TB@D`%Ha4 ! NX@Hx!&(0m8Xtk[pK@b.-ég[0tyZ8vz95]JHʓ#!oIB[5@g3,0TR:cGO-(^+.8Tlf EE t^{lH*7,IXh|}eX#^mx ~Dw$l!1}ϦޅK+EWPݠ;@FMoϛ׮n+|^PBѧ_(_k_"QK3kPpAuLEKntRxO"#j`"{zu:;//zMaՀ(E"md5b2UQT9OS]Cj&*,[۸W{wnٸ |O% 3"lA+*wiqf0I"dqw'gc;nFO狗Iw k &(6*YeǺʨqYn]j[Xk犷́T\LV)Z!t%rZ-Ih>M.b1D"#!/jVpǠ j~Cv~*%N!Zҽg-.]7pr3aa]@uOR[w. ؝b2;W𑐾W/ixՕeDb]ϰ c ߨ Yea8@ i9`ظSZCn˪G#l.,tgx#E;[ "֢;!,EoZxZ~"]{pro>J09sBk 5*#ei@9fE;hUڥxp#k \ڐD*P~zbtV8ʖ&T|y4 sO-kilѽw3+n7 !6WZ͈HhJGn{r \Z Ho:8Ŵ8M@ I9E3op/(TstOJJA2)@hkA$̇ j4#T2+L °eS ||#=8:[v2LXB67*}a(2:H xG P -`d$ Fmvl? "EY&}[=S ~t;D tn{BP qy-zhD~ֻbэ>!w H$UQ;nb>;D\͗g >f=^AYة‹^PmOEUؐݤQ RC~#u]^퇡!]U0PX@)QeCRc p!r )QKZb tiW:=&ZG""#Du.⯒k^.hX>_QG.Wff SC;aY6u\u/c :{ =@$c ^k\|#ݰ%ϳ-,`cV[g҇l_k(Я\p]#u-dw<|M=7k˄n53 X}'?7Hλ`qpϔ$Dn{NBGrW\!u9[=;xN $":5DJ-kej6  @wܯ/]*7uכ1S͕Q`<]iVudAZ[]!6u+la7rrY.TW~!'u_mk&5V{(VكRѢRJ*`De4(Dd^]s`؆pS JHO~+k#]_JtF hfEX.UDIRĽXtNUޯ$Wm> TZj9e4ALdF|t>.07SǪ,hK{븶:tTcCi Xevv8@-ᲉB;ۙBZ!۳̫kگn8ދ"025o$5RszI)tU8Ucp&o]'u^jRi7/)K)5(C< L>}Us*KuID1PHHeͯwpV\LJd"u\u6l5H4Nvh)B0[$.{+gEe-KhVqeDn~|.("AR6qqڬmLfRg~2XoETd`e%9k]5O^X]Cp60\X՘֒asXl׮c $l8[2J1]Km C[9Ƴ2ѽkd/7M,Vм*1FbH8KU,o gqun 1h> rʯ )%զQ3f]&>vTJLi{j׌-Au4ߍ!ʣSZt(L(8Q E@f/EbDZlr˒BQ8\Vh\L0Ym201|3N9^a~[6oRz 3˲* 07G;WU'r0_~Mv(Vj5p(`"Ka~P8eʫx\7n4?u[6ݹtZۆ!/O* IU[h|Xc%$ z,΍cJb]ѫpwtxhw/4٬0+Ρ)-HH-0d0W><lዹ}~K(͎=ȟJМ`$&Wu0daX `*o.w^}aFdYnƭx4qD`<{^Qșru,PƳӷQZ#˂:Ug$E Cq[ (9{Kt5QwYEN?m>M0P]tXQi ` -'ϻ SmC3*VsRgiK qluUtqa^(@Q Gh A"e 6k N'&qlsub%۔KU~p9 <'e9"n3;#hV,FPyJmbߍQѡR0i܂*5%zn!tAFAtʹQY[NJoA"a6lfJeՇpKv mdķm8asdS}|TX{ߥp0}Ry* cЋ!z/K|9S85 u!3kJofzP9]sY1p\q<X(jrpֈq8j1^ǥO.1T]{p`"Eb'叕kKr{a7-a I|+3 jW -"7Qp-~%gJo*vlqw_MyTCNz޳SUp˼q[IXu`^}.j(t/{,-"gmBkp-< hvjʮhLxӡyJfyb9sL5$d.G"eĄRt%JK1ьe݁B^cQM"R]ö́[Kfk(z G)aҪzy@v5'1cpU*`e2>$6Wq'}±yMa^xcbtj-\EKnFwuAĬL [v$I:Xн&S^0Zb,|;t:_I-p84R6Mt(j-/ !kMbT7yZRIV{G+j_ ,kж zEMTQJ2= MbJ*nl3x+3qK.-n]lz J(Ն֞:À؎ݼ@pRͭN\1=+6^f?ivrWJbݻ^:6M ɕ ^[F~!9U=0]c!5Ӱ쯴W ק}w,b9=zQqejEQBծbE*@5ζtMOMQ(kǓFˆ xoOjRͩEv=W笣Fiw EN$oB̬mK]b9)XͶL!M ?e2K7׃ꊏ;+]BZ N|܉Xzfyq3+mܫsoG3tr kʝW}p2' ]<l|??3o4bKl5L~J{gx*pɚ<3Q.!RvqޣLyk[)_@16ADsD&.k 9%&(+ף*p]iX#'f1vop= !T8amhatOr𨕲N#y9H=Fl(`!&Yr(6c@5E{L1i 뾺Ipc5v] 7a`b-:ZRn{ nޱ!d, gVƯQ@A 8 J 8l3ˤ{ިŒ^^G eK͏ 1NJÀ;DsH ERAW3T]9m1!$‘]nB("D3e{w*ޫ21!i{Ua{M޺]~׍"P74xU֘& ̻'xEl:b+n;"+WŎQY'7e4L!ev8mMϪQ^=23!uwS0yF72)f 7YӃye8"1?0QFʋJ<TDHvo =!r hd6˺xx M0ƴRT:jB׸p]h ˊDa0`ڈB+ s:RAeV\« k*fDJZg浜1dzmr+7^5C$,l?є5A1-̈AG#۬`#˖M-2zSsD<)r 0-Hagm5'f=kХNCNaTkzl\S5:&ў-*W;,̟L] ":aAv+ oӇ] H^?vk-Eޔ[S;7#*0Ύ sLT7`o/ Oez.kx/w9K׹3;έQ᪈b".9l/E0(ceR~Jvo5bieJj.U!G?A=si9NT:JOo })[tVXUŰvAuL6](Eq~4I éOu+=wNSu2-]d :q2LZ5VbYRmkobUURs`8xv߻~g+!Lv^¼ HƓ7߼]O Qk9n-Eun%5k== H`mu؁K>P/;s7/> ]`~x8Z2Er]bM6T_-c-l(q[/HQ5{mhw{~NhnDI*H$%i Ȉ )ĭ_@1A3Lܕj~r.4㦭Jht| bl ɾ:ip2:zʲO|^3e !%&4!ؚc]\Uݷ~ia"6GԗyK!zDݏ|n-h➭M]S%pNnsyv5qȸ Tk%UrjY.Ч`e1,' =۟DCi)I0WGl%cH1/\>f ~7LԃcT{kGߺ90HGbY j7F(!lEnҚj=ŨOFJdTCٰ:n1NpqIC0w^}hߔ沃 "Z~ uf`?];>6'E~UG]$ uZ=,;>CBؚM9m/)ީTPD\x˩2s&(cYpvFY.Q̹ڭ\жBG}Kq8]㕇Q/˙ګɦ*3vM&Y , -˾j}^q}UV=..g˹傱O1yln!h1,TҨT5)6,,aL 3yZP%r.A}ݨIqaYVQd]Bid ZQCh# V(E߰vJZtiD<_1w&ܰ<籬 R֛7A_:|Cd+|݊[Z!Tw *$t]f85kJڲ䨭u|Q7Ĵ y9AA R#)itu"@BP"erw1|JD rh~g]uWʾL f`.;6=׫ހQ(ᢜMj.c EPTZ'sqsf.gן$,c׎1?\c2nmw )FT؍0OUFU(iLLX~VOiۈVsշUz8| nOKg 3tN`Sfוɼ2鱗YX4Wn#dfܙmղӽ6vKO`܏% !dcj1@V oCδ]B*a(9}$& 86f,%4n+Ξff{e]Vjۣ~P0Gt_Hm!|m˽}p\zy p!Q:jg&;O. AohԌ/ޱѫYQu7< n#M٪ YVsOuݍ=b/&RW0:9^{5-s,s>| n_}TQl W"%a n-2I~Q\[K!G/쓅uG` Maѫ>u]E/Dk72Uv.XF"1C5T؉&g`%b9#22}U'3QP~hCԛVҹBPm2szt N5)$f M=< U8UD"0E*01IZwcg9|'G ?F>0ɰَc!;pGx/ةa:0[Tnœ3:b7f30SsG^[BliL|rz1q#jj%A/MM;KR ecRR6[Vδ5s3 =`!Ng1%oiP6pK}Qf0V p*G}G=?vh۾}C9spekM6BfU 7p?b@:75vDk y귓8+Ùʉm%2͕AAV1Fl tm5ӻ M EJK%,1?HrQ @wddT)6H\˖LD MC =|1i]PSkà:D9FeT6Km7Wѳ N|ڴ<DQժRxܒ%TdϣNoSxbUpN1]:A= Ǒ`UZ|2O¹ lx Vj$ԃ7c2My֩r(|ׂ8 G0\PX8}J!!E<\%Kg7%txHk3)Aɲnbis˓Ĝ%ZfȎ}U kUХ*"6,Mwj׺ Ļ)s:;y?:#¸FAmvz>2Jr9JZf2E䣺 qZJ.}9`hړVQ3}q6lIF;"WIP+"-b"֣Y-Ģ'mr.ǼJ~E1䓆荒#{ {30!85UR Cx9w-wOz]>^GoPߦzSs|> =7{*K:,g", ʐ^3l4t8BAnWy nn..T̈́%d[2" ªۇ6p5)LWiD!Ԣ 76]W]@7IU2*3o*K)'5[ *V]"Wo6 67kSwa\y\>Co~9'&RPvqU(y B, x; ,J؃)Fg͸ pDE`)*wQ{47NO}dW}oD^/Dl7/;`9i(qGG{ T*rf35e\[ ddz ]y,mC).Jmo[˽>G9i{Xu8<m<0isnm<5o1.LuWȢF9\iՀbhgkͤȌa2<Re{ s{|ӌC,@uP *hO@Hk*yЍn*R3>yv~^7|LD:<pћrg {{o[FeHowSbEFSi 2'f#^ zn5_P]D )^1{,oaV7k24O8J[9;:FnlծOn~0Skr;5Nׂ|y:!cnF\hMB \k[<7.!VlFq-TqE^wlZԾ~rqo@# $Ci=~>{zדn+|#`w}.rZgKJ'+p Z uG `Vv@pD^KĨ VGmɍS+7 oPo| tˋ H;!̱־j8 KqB}y A{]?[xj9Ene Uxud9蕁+akv#կW?T)25_Gm"/Go1U bdW51',/w<hюQm{]LUqXpVwHEoEW`Ma\5g̐FՒ7^ #VETĪo6܊ Z ۊsřҢݏ_v?E]m|ʎx;w7dK_ xONU"֝NAz f.@Wc[C: v%a!w?dj{U 3u7(Zkt' HF7@~)k}=հm8?@ˑ]:QܩJV2B46[W6# , !'ڿS\2N:W!oѮ38iFVS :N`SS_ezkNLy'Z )2Sڔ{Z=.DqmL]EO[$*#;Ƅ9a>=|8 phRU3>R)ik',xm&$g;eFJJ> y7:/)xbmld٢jt6c2L'a.ϐ)`7XvνV%L`"#T ,cRC=+[Y; _OKG_&I0PΞ8= *Ծde4(dҮ)2"##"ZP._:#Ou.yeLm PA)z *窄 MhamYͮZ~Iюj^<7Bbd dcJ h5N*zQ j6[8mhV{]55|irV4KHбW-y6kWZ oOKapͬ,tp &"a#~IQF˘׵~jU'9P} k󃃣rO1ҩNΞ!7&E) 8z>6AVu KW YӂH!Bz618K:{PSE.v,[:4WvBE2=dk=J*l΋vH)גiHbA&%YnkWM\^4ǯ]Br>T"E6M=^g;& 087F2o F aItvQ xYˮ ^iNq,wķ~ Ɂ}ݽ͎vf7qJj3C'FD~s<f1O&q"s}׭g+/Oc񬃫kS*_}&0=`{^&<QqƈR86?'p@h]C}u3 6[.ڊ\Ü1#:Kg6zM?H1808l*Znt * ӊԑcn3HNF0T|{ВpBS$3; Htt\p6w{l@m2D'{,r.k9Tn[,NWsc_a[=T#9Q12SRY_h*yNTl] RͺZ_MO. o 7V%d;uf~c봱@oSYuϥj2nl䗿c I٨ĐI3ّ,Y`db@ L/HA͖ѢOZ2$<^3(oTb$6I/@ S d|1.a `Od $$'0@} Dll5$oov'j()9sW.!&^Zw'e?R1u_^6i$ !ܤ& $ِ\ 9-Q<=?I}M>== ) $HI:Cv̐5L{ܷfSDI=T=jN{$nlh|d'5M g[| H[,!!ָɗ .K!z(r[5tII!LWWuA9Y]~뮿1@ZM:3 }:ӌJ6L oʱ$h/{ ${ !n B RI$|tÓTȔT^HH|w5vnd$A;-M 8g]Nމ'yͮ$9~M@!JEQcVC3/> ׾yeF- ;9<3YcB@O/Uu=mQZ >/NP@ N *~1U_KBAUHB󳰵2@L+'&ʬ|]9i >qZ}$UZe f@,2I$. !guZqY{ $OĄPKUs[v{dsкpO$f)5XHR\0!mp->%vki\HmJPB'ݸHBCdl0d>}5ĔTR&dws<-k V~D W:vH;]8B0GM=[MS}~6ϟκI $K] 7v=man3sΨI3ЖN_Ej!5ٮ{$ $əXIv[ȩ{ zi;lհ\-wq<7w>|n<v]T ]-=ⰁnqII$<$!Ԇ^0\題7~y+6ƀ6 l l3L\o>&C|: .aݚqnƿWI;^BY&~q̽Ύ?K-بu֠C$ 4x*Y 7=Sg2k?9%!0(K(1|g}\w\>Ċ餅ɡ4o=R^z858xyC5C0yT&e~D_=ɕt0@13=w:3ðLư Ʈ(l%d3s"IY$zR^7 lGS56:R({!(9iz 4Kϸ$309q8֜]{/ff.foR-= 5 C$A#])1yin|%cW)rR]$d6{~h%2'R+iSl_ @ޖ8G.?e;| 059=.VOWâvն6NM*@ྍ]GDEI0T۽*6}omvџcޡ뢒MJzIǪ qe%n(&LCBWW2RGHiB\EFBT V&n&Xɾ0kRPx `d!A|M!㍺8)kH& e{m.ڌ̪/Fb*BkuԲo⺘0+v1H(%igly%2|w=;z-#o=|'PXrL:$Bwwi\gMaP#&v&H ;欣Y(Y.ή3aUas֟GVuSZF@Cb瑃1"pb|+N3z>׏~wGKD>Űf~mSoTFZb{{|<òjld %H^ǦW׫;p7\8䪉R332$/j G9|9V7f2]͈ن-=k^gUfEledHmkf*#qbU;4Yfs%̆ X~TH]2[`+ >@'n& +RU cKeHZ: MPC3+& L(NeT0J[Zd@h*sWU1KYbimniS]QE NJq(6vQyR2S"JGؗqҕr= HhfN?Z# a腲S~!,uĺ|aBRm 2u)%呲ۤ` 8!'< O&D[$1('ߦWv$#vBi MZotJ z2L),L DhKxC :i5%D! pc=q[u8ϑl003ȫ +lU*TOGEDl ǂ4:B~zv43ngrzm=>?#//Gcd6 ްݳͳ?5]GW9!,֤a4U s$!ժI Ź[%T __+ba&P|dYR'! sdj$FdXE$YI$E H'!##7G!߆e#zW%3j!pt!~eݝŜUR1Y,JdO!5@DBI$99Kۀ/b$.I,tb,I ^w 4~ҠI<;9`֍ REVU 13IM\O2r(ƛ#M * !.{3{'qcNؐp)Tݝ\i)Ui]1TE"cgx045u2;Zd$fˏhߟu@avxv * l#D%3-1HJݕBƫɱb 42HE!bF7B a ,mbhmRRH)āaAB2sybRp[V]%Mr2wAn5j;[pl D^lp^Bi$$\I<,WhHHPd>!'lAojP0A+s/g Zm6BkK8Rj[A5`tDJ-ԭ$z޵dtewHH\sU R  pI3I3ӮM_B!cI*z,$oۑӱs0O!^ZN'FXjh] E?(R~n<]m4鰆;PP\~y϶u=V诓ǯQWh7C[{d鑬/{0<X⻻%<^\gO̊13I{5h x"K!IQ%*&RPj$#KC/} I8\?cxDcNV~}G*^H-OBD84U}6րϠ*Ȋ+L `aTRz'pvcOx R3VڝԋJW;^\1XD=djsywf 4M%4:X}Q<%ȵ"fKb]RN%PA 8u{Iu;PElAT$ȸ|\މCN&HIE3H( d2q)HQE ,YD2b*좈%C wibI`{DĄ&d gc?|;{yquvW&0'ρT1q{}!9̳-_'Z{$R BW-4-%}p,Ōs f4(맢];M(Dz9}fŬQQ4SHocN}A⵨Ŏ HU[uhrr" ׅUw52e[syXֵUY[lP1r8KI/ ` kkS cf$4p23=+UWiɫ4rv~N=l̖̒e$PЫl]{j-݇qH~B@G٤:!Sڰ>}khBIBNᐒk ݲ굧]]D4"2_Q #Jd'iiyI _VC-P!z,YB̘ܖvq`|< S@S sIV*@$Vs]t}7t7¯n<A"1$4T$wEd h%BLͶJk]z3p+ _|*IHM+}}K,ZS MJID]v@9 ʤo"TAS% _RزOɭ{3Ucl}uZ7H@ՕcK_9i$0?3xrykL%Ćvx/5ݮ,bR| Pź@[DY1fh1CXqF!d 3ύ|dp, 㭛j0 8r;'$Q(Q)z3F,Ik,,>T|y 1D# YK*EE CK REUŌV# g &$)Y=_a㗊#$\U00 GL5g7JnCHM#wH3e L@0MCϖ}ϵ~cUT(AR!>g'5$ j)`OvY9\^/oX}w؞m []DW۝+Ge@g WXTKJjGΫ!j)hF.+6E2w4ELR@O4e-s,WS \B4$Dcҫ"eH,JPۋt&0AF& $Qkznnub31"$X"!kb2d_wڻ]\y7ӧ3K?pMs ,3)JBVxSLr\y%=Y ><#"E3%OzH}^n6Ϗtj>yoNm#/I撦Zm"b"  cTWy%kUxgW1>|̪=_I6~N|Ͼu3#b:/qG`+0 -"y-b 3*JP"z Gq]./EZ-t-c ,IɃ`EߗYnv)AVKr@XQe B@&@dH,Y;^7Ê*쮺w2@ 0/aUME t{ӺDb1"`}  dp%1D _DF3`lFQR]'I0!>N?usk[%C*L*uz *uUH!AE>jĘRDa0;RG(H$jQjmN])QF*"P42JF`}R N]`$3%f٪*y]d]dKXHŽa đh-aeo;䪶77W4;uDUb78] vK5KI sz'v>/i6}>7ZjEFC‘2 n'J`]-42PBvVYl*Q2^]kԻ# yNH'\IKݢ^] B)V ç=}]u.N 3 "`:B _4t%Rۭd]p[sp^0]H^t P2Dd.jF'c"iE)vE_S)!!E}} Q)3\9iA!Ay2-(o|Din;Sl/EցTJst& ΌbK ʀ^b M%&F*nXLIݞ4v>lZ=<&`f=IB&7(ɶiAlxMKG~ V/oa>Arˈg܌}硈 foLl)j[|[~]iq szV~@ӄqV6&uPBlO] '/:5"9GpD@> GF5c)ḽ˨8$iJ䱴}ij0`v6qR4Rc(jj*ǧ$ܣVԙT/#TF0CJF%EMH1 4L, 4ĊR")]ED"qB*c-EKTR1/:utAmFf\z[qi4껩LꜺG4nBQ&ebIW8k~ǿR9G/;kyI{}S.WYiA%^Y"E*`e(dH R$d c&ce%Ŀi㌼o4ٖF2wa(84Џ7$'`spD l,=su; ̂@8F:eBnReC#ٚ6%U#"Uyi""LmB2S/ԧE##^4jzM.&Rw>) 3>8JXb >u;n yE ,$Q!Jcsא^1ܗ.;WRKwHs.s$BU \H*RǏPX0c T#,cg&ifΑ8=xOVyNt4Y| \g_8ujBsPaX/ԬX@8v41A"sI)7 z}egYj{q{\-m 3|Ӿ7!mtw08a7̆dx NĴ}' kI-$ fB BKcMʷ5$\%kqWپ-1*0R,RHI% pr 7; F+쮆]`Q%'PdG]fl곎(fCE@@=ǽ[I|O+qܩO\-S4@ D`D 19RkGGms{]}n;{[im~W[l֛=~R,JCW~1h֊&霹rut>nWx`lc0EWۡA-P}v=㏽#X Y8LOvJ/1 ^OMq5~9l,ÇȋY `/3aP;cmSTY-j$=Km;Sq7kЭո;e#f[$NT8]ocX ,#(F;Oܙ@Q 6{VL:$1 W7O`0hA 6#0Z=ds4'co!E;[4tLjqB}5=1b28gIӫ %!X@#!L=[ P Z%  d'I˾| 2GզZ!.({mͭZmyz ۭ mSF-MyHQd) #T@wnWus&ox^Og4U&ԑ-jiJ}v,x]~wU/f@R<%:Ť̚T5TʕD#暁7 ) % VӘtѡ!y]Tjl+)b܄`f}a,QC#}ۣ9qS)IH_q!8lmAI$&_]mGҞ.hw#CD椅z2DHkG2g >G}aYsa<J4>AYMΒ5ﮀ|h5)7SE֢ Rx†AOTsI쓫[6ǁ=CyI! _zcWs|$u Je qXTlZ:ĵ\i6@4bP)/PE)4cF2QEhʶرţw 2*9ޟ6Ho܍sJM7K7 ɺ}9,oe<چj儙&e^tk5lYkPLP.1@/δ:TT g8%7t@%^u0>ڧ-0ts٨Wƽٱ J3y@I?@.G4|A1,(7KJud5x,iG3AȺCғ]BZU_bQYR,Eou]^Q`׿ MZ HL XT6R P! ВqJ$-  N̒ Q̂ (i(db\:RG ; $_!}&%k<4{02tHsMHd,@Y 옭A sLZym4uTYAug\M٥)'(亲aHdƝ4>ۖG\}i;glT:himw%ݤ=P2NV\ 02$9#JdGC@sPb "PnpހpE@yg cI  '&F.a3иl46Ǹ\.p@` 5Zr/qܨ}+'4f G3NJ MdUiQ amZftrC#55[U XK5}$EO] JY"z)H37돞M|i>d'̰B׶ 6,p@{N]reTs0\XN=g3 Y$>mFvKK2%Dk$PX:(X#piZ>+h.h[I7 Tﮱ T54!s>^Q@bskd޳!m`v Vwf;dթ@,P'5<7LX 7vY ZbƊ$̇@Q\l*ksduf5HKM$&fH0\T BYNM: 4A@Y!L},N]S` ZǪ YIA"-jn]D:ȑh"DXˀ$D2IظD 4$)pI$QdRD#D6 ؈".0I"0N&$LHIReIbkZ/dʆ'+vj),̅" aRYQ+-BYd 2:%͒S OdޤKA*/k`ص`glQuD4!CY*M4:Z?*r,#}L!) Jk:wl[I5Zgg}C,$+LS. EI"6%@9 @ߠ|ʁã"M:RAy>?dؤ'hۃiB5Tq RXW3fEYq#220hL o{mֽ\nPid+q-9 2JTcH,IF2a$[_?//G5Nsή\뮨PyU)4S %W$Lb^W9O:'\\-}6V44( r^Im^;sUe|3mޓlkz'Q(@WQ9‘iaI &SdS,E(& 3kGk[ARYjMd؈-%k[2 I $a2$f$M52$S&/r*3C>2UκJ%̗,AZ& uJc3%,)`FD3lcs$<DVEdʁװ &dfsּn*)Q]W߰HKxv^%s.stEt`d$Q$l  )2C (İ L™ aH%L@ZkR*x8"`"Q[,%0lbI"9u5HNCQ&kM!LBլ<\MCVLL?ps A faQ 2bA'L&ȫ/Kڽ/}KVJan€Ѫ܁f*]T!&ˢE"!N2XAeOwFD0: uRC34>eywՑ6LgGϣ;j +inKRXt BʜJ 4 3EA4#H M^-d(R૊ሂDHBDr2c셄4er؋Đ106MD\x9Fl]#>fș'3FD`m脞n a!a6]qD}tpE6a@ZJbbcm8ns @g.C#LӮ_Ruۀ$ TBAD3N Aـ,C:@MV%UM/CLA$ (RA X0XQ(&Z#U% ړ{^k骖2*x=޻t?`CΣd3rIM97oK$ &ސ@\gל$Qړ [zwNNwY/ix K+7 AjPJ`5:݌"2&h\0%$DTHPk 9&n-rz;w!@X$,YHa4,&$KE L0&@4LtŔP dB&HF(DY+RL@! @%d3fꁆ`((I) 0(:$8B4bhh #s˗b.:n vo8Y&KbhB]"$3 I$DWb$,L覭E56Jaa8i] N}[\<3B(dDRe@7sWVߌߡ!10HȤhxF j8xr , C=}Ri0@ ׷P8lcXbVMJnpE4 IBI]Y(aJ.bZ4 @ 65) xSpM]a!'JmGlŅIa1eqP!UAd `h Ijz;D48Y6yJL_]4&& zs19):2dD/,x3ًn"hZ9i:ImCR>d`DF0"~fmvH8^ˍVմlrxfg^pfEUi;r-N%ZS*+z_VBe$4bak/Tz8Tt|Ԍab#$ RDV#Ɉ̀_ 1?勴A\)}hO!@?~Y>lXL~;hB7 X^~,qb~ÿ;-.(b`\{M|FrK|[+U; C(pQ!Y(j c#HAL0d smJTQ6r(nē}+ Ճu;A9wS`~\}]_ؔ-$ms}gmiG`*[w]vK}m\D5T+ q݂򛵯eq6=ERyKUBNm#yE<)ͨ֩oDh9Eh2W/ׇֺk vӿ'ʙ:_U sYJhra=Sْ*?i_Px)GCmXKG@7Qn(͗Ty/d"L#A2=1/iɌVcA'Uj3S)d5R(K>M {00@6ٳX&_o6d`#+ z9@Φ4UF r1(!+BFXO?a&RNC[js[ yWV@QUaG"s%m^}(JDی8E[CsӺ>rcU1;qU/~WazZ1 f=pWttM)5m Ii/E/SSd5-pD+c%;d5KIyb%vmZqtGd~Moh8F^ as3P0Ʈ}/OY8LݷNp^SL*U{Lxw8:6ݩm/wrdBX1ocF+uMEUW,>[ãpbydkˋ+RR=kiߎ$]iPyFs`:a8kaؠIx̦v{M ,&E e&)_m"sO\}5iatn.q:&lNp褄!׊O+gW,V-+i5ȫi5hF3+-g2[T=ۥkrm=zno/V[㹆,VTӸٲ@={Պ{QH@bAnڷkնoAcy#7tgx?hRAc] /=3eef‰iGZm="RV&2OwKbkj0Ly̶>Wz^%s>q`I's2ZZi:K/ku[9{5ue|j- ,ۮ.mty}0{?v[D s>q+ בaNNRgYq텧ZXSnBD9z]tEW'cImU5xo AzՏ8KɧբiW-twC!Z&0&af@`da7z;f#o{H0# \Vq62c7zɕTo8(ٷ  (|JT* 4C\M&3ZwGŏkFmfQH`6y,ڿnAPf*b+R} vPfq/cc9zfRzXꟂ+X[gi^Q뎤cNrļ|jvM_=F"<-]CǴum7izm[ kHoɆѓaM52J^R7BzӑsO L܍0]jպorkoR[M80fc`i@21m>&,i֝wO~{??X.My0n~~4d AY8/-cx=4)>nkWeB;b4Z*[f)Wz/fٿO3Sa5, |ZpCk>𥉉yܐy37{E6æiXF+FmM}mgvIyv7Ky/-/hK.'nZmrɥRb> 55n, [Ɣ̡U\:u`WT\SB4g-㳳FZ,7iTŭ%u4-Kç1:-Fw/f[=SgwN^G -~ 7vw& rK4moo]P-H8݇jIu|QhFklFW{vv8c='tYvkVgT';N+ڷ0[<ܽ .k^U n- mqq)Iз+:Cull);VLN{j nvK1oŃG4ce\`>MQxX$q|2aZY!W ;O{6ۻqITl3ib[ X HW^,Foלy6ڇ7_S;}i0ӆ;c!={Ojkk2^rD02 WVp~{DpIgF40odr7GUMaֿܼ|7}Hw< %w]O9#bsJtAxJ#=J{r4]5W<ܠRME_-C>2jP2E6οgl< u5S2?Qf$[8?AMi=kyAr?6ʘС|H~#pJMDD٦ET[do=6C#5ْhF1$s ZEגURyAQD{=_|5h#yYTAQ1d$dVs9I<H4r񭥒-z\t<e#-ܷOQRaz`#bg=>GG 7C^ xȦ]8"Zc]-6>{j^r,}{KbĜvIx6j>Z}k=a> Qo51dV[>B^Bژ R7:vxmQg7[wmug'[o[PU_<߇{OR[fWƚ2 o/ak}=d|z0$FF|yhe_%vYVҧr/nx~)i4Ȁ1CƲFmiA8 &c6nvC\ ScHmN;}6Z͂],B2gy{^zTL{ 0'0`)Mǩ&pxxRBI#ѷ0pld2޹m޴H`ΘмĿkv+{]ޝmS14^ ^@IUֿ{a_5J]KopTYy;+eɥ8,)ҩW6e?ɖUrƋ\heMjT++,dV9׾ސ;ޏ7p0Lv.indY{^S̍agd`b DQd{>|x{e͎lRJcl0G2~L2-.=LVJݰi6,Mޚ;Ws3{yMm껔eG3{QgƭZNs|fĵX!ˁ}Zfb}RʻjI^aPc,q16Nd}2:/tepEJ+^:5= pe*kzק!mh0ҥ H0a^\hmj= 'cC!tVjUWv ل(07w~C5Ꞷm7rZ@0zOo:u fCrs;&u46 ܷW4=,.\m0^$ڱW{7f l<Rq46S@*U$"FC0&=CAmlGvBz ]ʼnUӀoIa3sZnIS-\նm\XYmN]wSf 28dYށM|=nHɿ|RWBۻak6qm{ay4mNfx0h'hJ9q6Fw%z8i CĴ 7:ĥ(:XVNTaw5Q~G3jya)Is.ձ)){ꬸ@u<6 w)uԌ0?m&1ן @xJ"bXa\PzǶZkCOQ ?:jԱ@n(x)@Q)Jr+~\BFfS1t$x@zL\IfBXN%2}cH) zIcf/BWrKn$Im$~3Hz?ʾE1־mq}/yUoO쿹`$v}㉋y(BfE БTCBd%3$HNK_Co&qQ@E[{ʵt3bf<_C6McU[nb5JT" ^Xb@Y R(v6CwPNVǣR.@$K! a %Nsh$ 8 WGD_\߃]4pl:F ``<ώV\O+Zk89#{LnӔQ}D&)zLj߼[kjyXKs,SC[Ffl*x̳g?AiJ͓|#)dۦI'Hro SF͡\RB\[^~ۏנ+Lڿqh04a(Ju?>i7pwxp؉m{ii(7)^[[DZ"p3U[]e?Gc)vO)ıa_o_ė}8c^Ӣ:QT[g\vìL{m1`<%ϙSN/A$~yaSRׂYs=&elٮlmU]ԟ;^>F|sUTޙ,h_6ꋕ 8Oeq5U_ -UڕĭoӵӴͩM[I@pʲ>Œ]  Hgڔ@(db9xR<ݎb44;%-H듏QfҶO ((P-8e"HvFU}-\ 2H0@0eӄi6eQ4f}\)Jpڥ(Z3 Rh}3P hdOuX\˟yϧ)!9 x'?k#D2&.F]w0g%̜0`` &084| 0}!nJmxmRCcFW5l76-&üt,<|=O}p<[𭊨&9ڴar*k`@w$fχN,S*9ÂxW8&1 |یI%ge_m=bSyjr.X> {S@26KfYd{ JC߾ X$v3 GfAIB~Ü)$g%m.!$*uPg4:55;S k5Ւez8 `d=uTZ|k.Vo+L,fjy_g D ௛JcP ݥX.Yr,e$(4I$cQ_ZCmL\L tLN1]0ٯA? (Ʒ։D'vU?Gj賈GNs84$F?NJ*! %OM'9"nǑ`c c!U!6xc^b~L/ $3jHO`Ck5q M .thIqd10p*iKss^,'nd%::w@MN'&3Uʢ(6/c/ g!D ٻ lE{%eYR;7cze40UӃ@!PZ}PԜG?X !a)&V@ſؚ~C4RU$ 4$$'ݡOI1$=I p@2"M2:iV9a  /H MZqǎ^=\\Z/bࢅ|W`ۭ{NE"\0K6`)f\T H@dF !ܷ,!BvF'ن_E9wXZ>$8*hoȩ*]\D#[=:S78ɕDV_X`,9ٽYأ m~BgTkSaoHE-G$(XIC}x̱ ,(K6m'iDr\NL$XUdANX R 2q[F$妹 #9K: $DjBj$BIctj_}2@}<@& Y$ yZ^?tB(ܰ.ۍhO$dWﷵt߽+({pN%O7K`y]]cBix@~̠?{1I6*$ fl!7ѐiy@.RJo\Xu{ lm tc3|]M KR-ћ}@0Vbi~%{b+e-s;/0ndf3 I-y4AJ6ka+n/mRM3E3|l uڬ2 _¿H$T4[bp^.hTnf1H6@=\vY`$c.%}[d@u-\4"zU_^ćDO}~V%Ti&0>m%^Vsb;RGi\0Vrcr@ ,1g5ЇRm͑yȏ;HN:)4TE<XtU~j@WLUTE * ^e NbI?5 :sw􄂂ÕR ` P8ҕ66ySi|1OuX9YĘ$2>.=xV J3WjRp9;.6SYVIԳp;u+fbo\ 6o=# |6^U ڱ>G荤;{& OCMSg=NbXq̾očqҿc PЀdȘ"2 egҤt]OB9 b_?oMd1ɔn>R\>𠛇Gж xڿ+ B"/xtFкЗf1'b) ,C?o, %%j[XIt!H~$pZnd]g@"{=8m1ioy>CUfcx5t9ԍfN*/NmNbgJ%]yr䖢> 2 ~XVr-z^K{_+؊LA1ǜUU|x*m,"SWwҞVuwnMn%t9ғVaږijYWkfOxJoπނPM% i!il%uک0M<}rA -^!Oӽ*1hֱE *TZCGqVgI^2eZ0r؂#^K^F2yl fJvO?MʄֲQ/Gl=b.&v,==ãsމgR yyc_jq,ק(׎l6 ϰo. ϝ+gkqV{dp%RY71Ypy8GVsWNSFmȬmg^2CY.BgQh~:U# {Zf30$DI! ¯â/bZmUbX%UAA5_v{ܗK,,n]NWU**ʴ"_ 9 *ց5` -A]RUx$T7'98ϓ%;DL*%%'ք>bj&reޒpYTjgG0g$"& pزZ1F1F]P;6MlᖐH,!!|n nnu}W6ȭyk~n9~P٤ߧ `@NW%^H}!/_}];di1Ҋ§G^q9rF&+wlMyz>cFX3]5@!dhHo<62$ڤ B@>ń 'I$!H } HX`cB@>*IK$'ضCI ݡ >!P!pv!њT: ~G8)m;P'{ni1$'qOx&F˲a+EDqjvB [|}/ w_lV֒}0BSXy&3+_,v ʱ/%0~')9d,cK_A@Ph1e2 pmW^V:`ߚ[Q?W[RQ0ww9XfE{= r5 !qߵ@xё]J&I9yE:cj%cX]:EwL&۴=IBd FskTY'}JR]I 2f5}dzkezO{ xj(KV߫jMğ>n OHO.Ŷ1mL5|7YŶ c|-tC:6Hkx!r^($3e]ͬ6&P@ca0k: mFaoT05 ' hsh;PTs4}՝S~:I9ɥ4'S7;Pw[|;C쨐S.6 $AI2F: S i!s!' /3D'eI!5;]Ğ7yCoNǴX{. rXBd=k$)O/p߿s4Vu= ‘pT:lڠs%NK?p:1H  13PW?Zr|1?**]` F-鮚+Clm^1`[f3+EVlaKm ߭Ib>$ cp>s}}S৵a]4 ovj´2%XS(j(*H"hs#HD@~ީiE7UƖ\}Y R2Ե6_J*3 3Rӌٷ AFy)sV¡`}5 !LFOi{&0!o_A")7TVO`KϬ\x5{@O5KY!Ta`2k0Ġt(M`z3kAX;Ej#M?AR KL#/2]Wm̈5̠"K4D_+;oUK,i^gʹ l0B.Dd(({a$j~u+PH)^536R} /Lg hw# O| jaENbgm 17ɑud6! Bh SF=llg :PqֻDHla]oJTmPTQ7LB-\4tA^'I륪A"YPst@Z m`7+@pܥe#9FS3"`(璱^zy&tK+](-E{E[n6!8|.Qzu;{8Ghc eg);K6VfZ$_[h8 | .< ,UiChXm-[PʵE0&n,p~{Jٿ9%yqHE {Xwo`\R*V.Θp\,C"* b3(1C)&/4(8JhB^]׶~t:A5'Rm]\ZzssZh޴WD[.YEk_k~4|I͉Bshh H4&CO{f)77ri۱%3b@hWSd}V>ߺ'>t$,x2- K)*ʹdmq1mrRс= \{b]a_8T%j<0QaW[Ӥp):J0klW7K믬U"iq?=LH,ɛotEu^Go;o.yEFK0UIfnnѻ0'rNO5!wfzF!(Oj 0`wh2BA_Ԡ9L:HC&6D #TqjI$ոjRmo~Z>B׿ K2DW=1ߓȭ)<]1`[*[[}4!g&ds.Y#"BI<ȇ&.p~o@]] П0*(4yHC2 C>.ԏ,~$(E|`" T:߰9l8aw?Peo7oq w77e01ɧ6<ٲ #cD@"W: @ĿBV'` R11©4YaP4q[Ë]TF  zmEūt<ԋEgQ].kK9߼|.D^X^WUC1l=ˤ)4?fiSmv-@`r(`fLbeB @l2efA2}\`p:u]?PߊI@YegWҢeOixL!/cn BhIL?w{n9m~VbfBPd"oX@!" )8,$=@>zB}-Oa5mMЇ&Wwq/rbFj9;DHߦw53XI^%s YHG"VqhЄ}'=~Rթk kI~pp! aYwlȁhx[aZGzGhY'ccbO:jL$COm{9j_&<;RbSkb(cآZ, Mਸb,9 }sU%.ma >OT y%!MM{B%6|hpHG # -Jz(RTFT ݤCyG|ˮSm}L0 I}{!Bsy>.k~4#ƣ 1Ž&H4Ăgm"@os?Z.^but%`@o:{S]W]DɃGNDF۪WhJ9z Ǚ%!os.gkCX'#UU՟O3qι$F.#$ 8$t)SjK =Z3xԩa4/Q)Q#иMY fQEU2Wաs GR*M@M֔ UYz69g_h؏Λ I `y>G\>b'nvpq[$XgM A1DIŰ1`F41B@Bv!WP{5 ֐Za]E Q$΢kK:Đ?tuA,k] .n?MSJ{iӅfEKӈM?^<Ɲsużh(BT%}簊)~Av'<У4dӧId-VK)\mh-@.\ s?iF>s  }zV=Їx5P2B{]1$زw˷P$PYڡ١}OC[q+ˮU}￳?͑iW1_MQ5@lhPB""&lBJ"!Gt*/R_j2zb㘱fEmsuUADb",cbVbC0VFٰj Z$mPlVB",ʆRYfb&h82]iXUPV [dέ2Q`QESO/Ѷ40f FVg\fk)EXH0I 2W9WA 6/0Gm#à)"bbBFJ7N{>ŔUȗ0'q񔢬VHL RdE㯴;9k谫Mr?cm}:b-#vAn@Dj3P3XE&QĘHc LyZXIøaS`gb$m(6C ו-4)sL]qjDA1bȆAB%\^SOSLƂAYH2~{x(NJv;V*j_ r f5'ܲ5 ZWjܹG'85 m~^;,>\*}εRgs>vsT8v:=t_~~iqi) &Mh2CޠI3&^kNa9}$C! 1+) gP:y𣺪Od{@?QkΦ'(Q1HP0?c+W8rVJ@TUGkÌѬxB(Qf H%1ܲ!D%/QO,Abķ#V(yɏh/^+L%K$ow#Y>#}#Z"E""9p5uRP6LH?)b T{k $IqpO7%@3Ф~Ir"Ca;e ;ot۞րDܲ 2u 7w~oqLأb"Ic8Nћk*9&ņ1KoGc Ig5m|ꯩC6ibds.*A AAرHę(}\T5Dd$}̴8j269]`2m ױT,+VaRf a54;6#`DNFwl<7I" =>ָb 6C= Ȕx_Y ~D#DZHg-G [S&lR 2(|JE Ud]+yJ9::ðpY5k(0^s \(HwmyqHO䟑Zn%+OOWA2wZ9U>|I%qؘ^hIO649"WẠnzOвG#ʭĞ|F(ja_ti#x݇? JDa}xf) `IӠZ!o#3=~UEw'ot-sI"]ëuJ~'KZ?R{ #Ksh52pdЪЁ2Aa.cxg経[[ia=c3_g3<kc Z*"0#-ZV~09@mW *0 lPc@2ݹ0G}\ mp" _7D2o1C6`Lix*){t=(׵1B"=^JS\TF-Ec,Nut80Tt_vxhW\ e]6V:@=7}I?] 63Uu'OvH±6h-i) J$"/e&F5F>(rmJDxTw6#nΎ I̔HFxAG<.Л',;^f֏a+;(ʘ?Н " NoVb9_Y(NS+Zvyß Q5 '`8.~!,'˭`3p?Ĺu U*RpLc7G+@"rG#埗l)~ "" jKzmɻX홖? w='ivxmon=jL7ֻҺI[ﹴ2)}TS=Oj{dAd2@Mv?w'`Or:N敽2 ;4-Uݗ:_{L~'.9-k#cu]ֲFǷD#R#uT%}GF/K`[T@ ['nn^E1eHQbS'ZY7| g#6"^ v(/"-R8ŪWھf/YCjP% +4h|t ZJA ??#ŤdWjMPۇ!bZ$$˓aX9#`榬kCSVxfTEl\ڠO:kMsRr}(. |:2W&rOB779;A*M 'q0Ax 2g MVJ`X֥ܿ9dv4qI&nFT(mune &_Wi |e+-5ICO~Oa6ЫР L,( e#XiR~`/Fm,?X!bb2=ܯBKB3ZzWo+yzϧ-89UX'3saK.K˄R*W\;Kĭ&WlG{:<Md_Hٔcj*0@Yup0P"YiD#l䀙1Rf&)b~dZ#n ~"ȳwuf(?+B! if[]xۼKtm%joƬYiʃgiڴ$/gq_ Ylas>=^vmmou3.E&E&B Q265 /`p6FIS]@sKQ!WI֮+x@i!af.8M_Ub[~ϭkvuLgĀL'l8X殸)dJ Ry+nwo^4΁E7(0ET?u U!UE"-PR.$dz" A A&EsQ& ^t")dA!jP$hY,v}+@Uߣyɛ.i)*6~}Y쪱X]sy]ry̓.8SUnק?:e]GɃlCf2v_^տJ%|f}f*}ɩJ<|IYgVȟ\+oB{vpRqg9 =&,%8됶pV1k2wF*BVL|\xS!b:Q-?#Z<}5z-2T6@f~ ĕB2t$lz3/!J"3!du`W@ | MA'B",skgN-lF7ZҊ7/^MQfxDc/OMaGf/%"!o t7f7MʼnÃ"p ЀāӶd+aoZ͈ 7 DH냻p:i@A;6p5m3<+ժfZ lUirka11X՚$/ZZpҌ !AIA;Z 4F(47(^ z\xMZx-xM BB, s!hgǠ{ة LmET`N3Z2j;S</f匱fX+hwG$*]yo;cYV$zMCI۪:pj3{ .@" af;ʚ A rp4WcUrs`.S vA>'CCu ڬ PXTWfvKzP:ÅH ۟{?Bpv,h"CIRkHXuWX`rnڠ(@xZILft'Ω*҃HIUzܭJ"oNG##H"b0Ahs9'9/G^)8lĵWK坷l :!Ҧh-UK3{J),cC !|qc[LL<}SM 2n ԦAdI$!ѐ@YwҾ@ٴdhngm79Fi|62sb1#.r*I儉Ȭ/WOFs'zOC!=[(n`,@e0o -Y"X( I͈dQc+4! ;:ĒHw{Nvޡҗ2 צ7] @do0Ԓ@0`@$du$7l$7}RɒHXԈB%U043VmIYPAFs\@a# } }UWM-Xl}yÔj4qz4p_Oe'9/sa b D@\5eg-P֮e.M's^I9#c$B?DZzI9 ;ll3Ksvɇhɼaws3jۻ%T#}~AJ_s} duj?讙Het|'XSh}~jM]Z[EY ?9D6 /LȜ/=u/S01#rJH I0;m0k T@-&R;&[B ü-ԡْR(rS lf_% XXTƴiafLiR?l^t*0F3-)/gᵲq|Ώ+g\ @3Q\) ,؏ɩ'P!ܰm'SbP5;@8ϵЫa%o]kb{.d'ғӰd`"28[87)B) P?s4VXE>̉{1K€Pa e'2\h0:$OR#i)xP{ul's fV6` ytz}ŝC`'V$~։l{ć?.:"%_(5D%y녯K12.߯vu|" xy@(eOo5s,BK_PMGF))gmٖ,}sB=kt5>ąZ]~9[b#YxuZSa;N\{w2A;cT(pf<M If%FXO}q}w2 ]UB" STqFT\p p\hZ0AE~'s'2)"mlD.qm=nros28a3,yk1ɿ&H1n< ;$e.HRiJm%BG58/a[izu⽩xXcA{zb~]묁e8`y#uFsSEr '!q&}jgv:dҡble.UL,iX#._ 2$s>Mچh)C=2P2}Nձߧ-nә 9rPE@AF1g I!bMScwyܛǛT9ϫ׉ḹ^H$Ǜnbs7я&,'ܽiMEJ+:>&c` 8 ^޽v?lǨpfzr 9V9h Gщ34\< B`+B5h l?q+@ -?AJƠ <on ="v+A,ԄY!5, xL&s%ȠAIP.fuc:߶%o ȉ"ԢmP /s<޾ΞQk~\]IHHNo!v]B\\IQµzoiߧof28Lh67:RֿD>$c92(Dr6[΢dAQor{k,;;c۴zr3d1k Kv&Sqg5`N`z ck^B2i]LMaPI/I듅v {QV섗FHmXS6 7|Lt?D_r25p2ܵK\Mu WŲh7͖R2}կFMy/uHt,e5(0 fpYݿ @?]&{sx]\Sh~'ЃXz^HVT!by)ȴH jZn\ymƒs|c-9SD%ޡ="g""(Ԫ3$==/+/ݶ(xNzDLN'ݜR ~wPMst`w/PtUA {{Q )%Mv\<U)&#{9 ZN?KT]jEҁI }Jt53Uu*9,&.Mw9+;'pTD}:2+5܏_W,9}MO`))$)JIK:kh$Jatm8|yVTiC3=޽pՅX.s9>hʽzP}B31Y ,)-mFq3rtLlxz2@fk Q7ݳSۛgs}_._G蛋Y/#c4=ϛ#&cT1`@FD D!s9s>q܌Il45͍CA b(\Kh4_<37ʂ0(ޚjHOudI\I4%(m=tڡXA橷/<6ky`3в[ v$4ˁE.zА:KYm.k %MɪC57Pǘgj2j02RGi`M63@(lXAC=N*MCBYBʐ.mj QLՎ8\yME t(1iKI/H # BBGFtFHTHaRdxoRCIT\Udnn^-cI,R0G%%Q۱a"}mŒ-i d29ꑤQ:~ecor7*IĠ A{bȁu*_son;p+(78P,'J,aW~QC |YKJG \$yfJ#qc3M8 Zк"w`l2­&!X23@ƦL|=\o9휰rWR/ RR\õm8c9nv#!2)ȌaD@P@e&P Hd}Jɟ'9==])1TTj*KDS#áߙ^Ѓ;Ό7D''-rtedԠv |$ ~^߭G}}w[d$dQ$?ngt(|4/ϨH|P_oUӧg=@|6qͩSkJUd[Ӎ:#{5s]x@l% Bh~Y.%$>W:F^k_cQa;-ț1*@A9)S-A$xgX7iei7)qd0j45k^aS+{޵Jz~_Ex1j ~)mM|*v N>ۉڵz٧|HIb=Tv-=wxED^_xGQ5ͱJgFm%g蘴K&jͲypWW-`דu=L^RgC.%@Ź8rwTU0G S5HP@pr$;HA/N`F80-K]w:S/U$|,wU PU $6P,Ë<{I֤CF.uL'5Htkdb8͓!Zi9}ŀ( /i- ma J]Uw0BSNvg0B-"9e,s{kY}@yDYH (3RRi;Rk,.4BκY%֫?w\,7"Wi{8n\-f`41˴&7jw3d8nCS3UXKAf󏙤׵#ns!|o*N5=eoq}tR78U_pD㯛h:C^Ȉ(X3#oҁ]'3BqȰ?$o.L S LMch%\eR?#P4&lFoZNw=F E5/u[T&Q/rn~!=$ ˡ"1 JqҖIr ZR/u:ǫknSOS@NgרE5@X.r2H1֢Pb6ja,9xڟedIk:f "k$ZJf3&  R!4(| p"_^ f<.ðQq~|:`EZH3ԁ Q @d"e/tw, J4߽ |˒H1*BW> A$b CHr-7XK]_}CT<ՙ"e隲GUW!^K.2JH /8<\!u*B(lЈaDd"=Oѧ!1+ 8+|/3_>Xy>CYyHJ"Ol,IXykxb08:JI$)"jv0xi@A|q{zAβ\jM}H TTRӨ\V~?޷ ۆ!Jd!zA`(1H,;X{Z=:mѫ[euBᠷ Z!U${ȵEpV,jS4[/n0c=e7;$e.7FL!S~lw? > )1 P7^q X=01i@~],\w}uu^^s7_{z|>q>Bzr&;qpMY~_ ̜tSJ3u:-lk3S|I`8jMNjk_aNFvxj^Z>T4qP[=L؁8#t 8ts## eɓs{k8cAMy#@і=U"n e:E^ eS 8HDܡpFR-l!K GSɼm@Ȭ-PލjK|h4#A͉R'9nEiyEatFR֫VwE,2*N6@ܖA  E޴a*ɜ$LYSim6Uih[,-U8 xaIf(~;v?/f?Z݀>Ex]ȫ&`e}@o5:`D:ά"Uu;cVSĹ0Ou [{k5˸#NrEXPeRdv~9O1EF~^_=eWP >+W]2NDV}c<:FGT+`fѤD{⃠#~Hefc=?^Vkq<ќIRZxXj~^ \{9OϷzQ/Zi씼7P$S9;ćړ}Zzc۰qKgBvR^%_OeOC(7.28y1AȆuP ̺#?%pdUbo0Su G}k1ɇ;'=JRQ0<#1rEY[obOss]Nguәo \-^Qa YT,_v@}BbBc` 䧐cuX,UX&s-HSm(WekPt~ݭvC؝6cfGï'PLqV25^N]=xo<*7@ں JS1+<1`JĮ%lnj5zywp"ņC3tj+<f 'ʡxJkdtMzzShL{6rh;%p73\hY>BxleQ)E5$pI RCEsZ`:rEN=F/Q_*^`tdЂK5Y>ǖ[5Ylj 1j{DfG;דqj)ezrԘ&qw>Gc]歈.ʟ |/kڙTF61 |mb{Oqˤ(v߫FLKm=%腥od6T4$:ٶj4O5«)=qB|?{GϋkkZl`c9{^s6: { cV~6#}l(,gML  'r,Tf"޲-|7~~J$˨N(tѨG7X|B)_]ָFT)+Lk("b<&K݋4"H?xyˆ )ӧN?oaK^q"fdOcj!1ttvoR%BhP>UTV4qZ9?ػe5lb 6]!>a&FOK t`)֖M^ګr+ܵ w]ӆ v5xouNw3l(ޖY[a~U> XcOߑ(RҴ͞M|\ׯ_-|K`2V*ZMʷH̘4_d?{-quwzngDre5p.|59s:<<\U_;c ]UWs'?ɆwKYivi_yv.eg6 +*/ôHv'ת} wMB.lPt,,cKѿ~.MWݒlT7ǍV5j)m}K12H.~c[{pnDͥYTpʇӶ}s 2׳GeሮZ<3jRׁپ>s;LQ^[ضki8%vee [^i#ŏfmq=Lr;.}O Vuq+G. 08i?UXGaAaOxU +C\;',dgb|m\]W 2Oe%I%&׻<΅֫ﶎZi(I x4|G-~>WRQUh?Bg ;C^Jt4ڲlB:l,*46޶ns|2cM:C :!5DƲGvÃW=s~\No@2Ӛ7t/?7G%$ob:55Zm Ù U"`*e~A(k}ɨs_i]bJwY?(Rvox#eI*%|$B$Rkទ"аlP441n3)Zy%>"`&ŎUr$) cUU,vDpTk+SZMI"t:YkIESXm1)^E0m h0B^ qMU6R=[m?ƷawLQJckg~^Ao}v^^C~we>@=7{&IhP:q:_r896JVzTxU#}bfi%!2S_;A 40h[gf\]x kX,?zѽ*xFhzF@]ev2\b1DF#6#/>-O;kۏ/Xl\v4T fCkQSC 5+;^t=0bU*Vca_yS%۟FN_30I =m6&Cv@};͗j'6?áǠ'q2 hso)ݯޤP:v):;~SS2U^WvɒgR݅fJ|2Y;Ϩ.Č35)W6?ѡ0‰p6YDUwzdmJ7MAJ{Cgve}5 4 ۯk͡kIZD>|LG[7ںY8qiM>D,yݩC'zT)?8ѢaVh%@V~2DJS 6} I!'aQ];[Ͽ3Hl:hp.oGcy $3WUJR$WRZ7P̉pߍ"2|Do7gnh924elmP$Ǒ(r$mZM`+~7ո{aE)C7|eB& lu!7Vm"2m~"HV<}{|*Ə7fNIތ`둌 c |FkogaԪPτ”PuqĐ|K&x @nkBZjӈ3 ;VIGbN Ȓoq9Z;íqԽ_u[Q,wח n\u΂.]|:l,E- "V; L',2X,(XQd:Ҏ3Xu+(P̲:\S%UkIR/@%{vm{T2:Ӱp5HKph}Vm &Ņ}'Owu}1|]KVk Ց&T,ta0Fc;;Ka}+PC!1(sC"fX0 Dl6_d^8giJ0e ;H~i"Ւf)} a9 LB\=Ss%cQGyJ{yS+eaWB'K_n1SG/JBDN3%\Q.kT7DHcI&!%K%_Uu=@&;G7@3 SX *G5M_az?6f!$diV %:ulXHp`A*)[`yw_Rގ+@J!C##S@F /wyGզ :D]"aJ24B' ;Wl.7Hmu.efnh|`@@H5- B5ja:P}p{C=~gqǏXjm~WN+@pO|20S[3h0wΡh A/mסd3vm_Jy-=GS()_onJ7~QޙאE:(S=tIbYgl b10Ԃ f]V*d I'TӨ|FRIzBn ]+z}IQ۳:D`jf@x'0iJ;wd \3[6qtA5}ic`v)ni 4ŧ"ʉC9+Ip(mZNh}2_;|61%ptb0#+akg=rRL+aH|kNI^FʓRyT}M/I:,RdCE)ђrb 4)/뎹Ƃ_o/ίC\ffNuÏ`.U1u!qqeT"jY ܘn=E ˦,HՄD4z 3N涾&`r Y~iU Ì͠d@PȉWűQ=ݰd.HC'!q|;ﯩ=#wQa);BEZhR.-^-3v8Miqݻ7:`1(4R+) 8Ec FL/t/hNDz f.⏓D|$ HxSJY&b@0qs}%̦ՁJ*AH(`HJ{L~bbQ.M j5+qW2U _=V }ڑΟ9[k=n pI@TJ2 SG_:~_$`ƾ:C+kp KsBZ"`䥤@c,I]Adh|_oGU { =hKoh"v(xg1.+*&Zl8$ ,h`c:9nR !d?q>= gzLbT!d0Uhz C--i`\庎6Q; TB=dfdbXeTPw.ztf9i6[ۅqP%s߼)4ӤL,R7%B⢅ y㹴Yp1Z-sc1 _!0Mk ",M<ƫڲgӧ?f%`stъ쓏q&cZ F=d[9SD26R" Vh0,'"0N2u#|a2S̷;6t'Mʼn~ 64BE ^IIHdϾA~{CaQ:2V Y)klZֵ'I`u{Zu*N2 ,qŕbFUUz-^oԚP : jk>[ kpޡLf ac/=SFJVV)32[k]4u9XBrYBiY;s]'y-MR0yhh*^׭|c-E Į?!o \IBpJx؝d=) \*nB)bUKx-S_~3\> jU6!$xՓ UCU5 uod- &/ z %a;ˠG%BE k-'9=}vBa6L?b4ɹ7vt׆-mIMJ<$2!r`hߟR1A*1*+= B0p3@ DFRA+-5!!_xOU^3(C /2jЄvDFuWϩH  fEmժJ1C898y>9'[ ݏc"G \=T/tzMꎚhR7)Wy 9[ܝ8~3ӻ6h"I A22(/I>s$=GSO'm}fP: vK$6t@E\(hY&F{  ?wpב`??E> *;'ܰ(@z)~'pGFי:U2uWg-n{/i굶M{, TGޔug ~wZ<|Y"(NWGWG]5oƴ#D@nXi#pZs7K-5ABE$*c?ȆoZ=,G^x:=&ɷyn웖f Xb>'j`uRF9I?v7k җ#ϊ:LPT!l3J0QTDaخЙP{l~vΙ{$MK5n#QcW_ij,%$H}rY-uDR*ZP 8U& RU^ƊSW7%(y}c FaQXYT $01 `JެqðJ9l*o|rFݢJ8YJ_u?[E9BqSByFNVCi .Etx4Qk YeH^K:@YpcW6)hNK;g`1#,_stab&r2O˪= R\@/L:8gK7L~엸HTN%Ajbߵ=h굤,ޅ yܾ$j@7\ .zUОApDV ࢁhy=ƅfԭg$Qc%4x+*X; m+[3o.&5*`(oATH0(w7 rkmRf3KHP~ ZX˭0oz7 ۹Ǐ`4y^IS^~< ̳.9//`:$hNHM!T T_B' L@ }n沣uF c25 dE |խHlI5X<21p ¸?]|da17W4!?oP3 \$8²vaӿ}_sw آ݆{~L8?BO ժ:+nM {!mm-aGqP%Z}kS 4$ |CN^-n4賏魯S~‚N&tWI"Jk:d$$me-mG_8{TB֨[%a '.V^ڲj2bBvgm>[l 4V] yAR)"acm\: 0DH yBعB4CgӬǝwKo6쮝à9!mMN\5(u `V<(> Ik@|X|>uןkϵ½ ^m ;Ə_KJI8^J:8ˉtGe"]Tm>PbJE3OEݣdZ8n={.Ɠ${khYD-PG+84R sP\)\e=L3-Gu}/oE콨mrnyc uۇhs'Ci9*3םuzF#xCSU0]^&GJPTz,0ֺ\aN% 4|oK代,&:>yV~5Bd)= ;䆠ʧSg7H^S=mp-Qn%a5B"&+0~01hH}nD K3Z|o67ͿVՂdf {sZ}47ww{cZYrpp9Zi'ɻ.E \=*JϖZUI4gDKۯrk]W\I>ٮ$/G3}''Y޶oeh=ka/_{R`q8q$aZ5Uw͎b:j #&Aiuv{-\}ow{GqO]ڒx̵6eUw`Cv uФֈL՜):d;'mte}FbAվ_؏AG$xg 834baNYo*Fl(G < 'd&gBk^[ː_X-"Y͗@JJ[T*kKow=97¦v~D`BH0P@!'7 *_ֱSM7qKUSV_1[ d7mz+V9B9c01Aغš-&Mi8ZCfiWsWuY6+ʺ?~kbh*=ar"bNO군9/dɲ7N`PAç&99 KlSj7ү-T .N鉵M)oVb|Ƃ2$2fJ - E,n ? pKj[abWL2aJeVkEWr9:ճ`ڱdWYd:%ÿ!;gG'lunCs!GJQ^LA鱻nn~q8%}Q`g zIۦebWpvTpT:1+E!SfN{Tpnorue٤t7(%IF\G~:;jtɧnӌ欓 UkX^Iuw\\ , p(iA~=7@$6ǽ 6yM9BZmj>WCHO47ZㆻݗurGdSHYr4>JR/ȫؑurh*v0ʳKlY-0 eV[<)<6 M3{[YuOEusmNHO\ 78 F{~lQC;~uMٖ_q JiΔFIy~[A>&ApcK$tuk.]쥒U %<,]8vUlO}&R[ =n`c[pӗV:D+'S% 1w i7Y9q/X6}O5σqRou9x U s&xc?X^{r~wg8\D`62\ͿQE!J\ԖDިTJuI\ܢj5?2Nq,˟K~4鱴JVr~(D o ᣍ6-oOuˮp:4ŋ3p.itY$]*YL`F ژB>хRPv1l}ܤ&6ul0蘭ڂ#g~jw2з䪮hk%d4!  7(׹k+( E[Gr3zL(7PƮp!G%NA'X(4\.H D"X9CCZW;u~}Ou1Iz/YmP߰O%:p]?m5{`+ףKHlWM\&1TZѷ%miI%V䭮67ۚ ?Km:^h/VŌZ{B$Y[u\G~*@D[h^'QOy|MjbGu${(s6q$u4w\Гy ,`AA&x2)y:KFFɷM&Y$>36PF,tY[Mu`&sUD@R}O>^gVrp:8tmY0-*ꬓ}T3=ږx/=,<=qj]=m}1&0)N$.0P4~ŕT0wY-z[[BBuv&?F%SQ*W8f R>(9Gf?1< ZLBacB$ӶKFf^p۟Q~ 5?u5R6K$:!GK,/߮ӿ?tcbӤ}}28,~h!:F?^E;T:ߍ<>CwLn[%J۰<(%JBd7$*gv5`f*D%v廝x# ja[ 61+~ӹ@(ndr ~BH Y302 ,4i*flx"9Ujx>7/ݒJ C^w?z·sV?1J+q@xw .$X-V' ݵy1m-w9:AfXd6+(2D1ߚDAMQ' %!v] ܝimQ[%́,t2V6k]l"Oh6)UDO7vŨ?}"'++k6hD3$A&$I[{-j{紇.E"gsWT*1s]^Vd݄\ Ja(oK6HQ0`ƪM$c#lI0 E[=NR[-<,}"Gp'C[$zyQzg~aD܈fr|},V͢dԚªq2uy=};oM7I)Ď)`ZlزN:KEg" >9 9*VRz|^ۗ?Ȣ2Odk]VkSL;}!!3iX oَ?S{a[KT81" uVY/5_Jԛ 2NNÚsX1O%A稗k AZ3?RfTFz1@8q-2idDFaKP+ܞ/(Y9[N44+n *Z*M@wBy-Ugs4ؓmaukC3lc$ok!D3D4MfjL2Q*󛕀q{Bd;2dKAj1#xږy b|T |fOФT:;o#/[;B躎UKy._X _?/fErWS>n 2q2qx1| r-j0Ly ͫǓh3 i6ޑ)G38ZJ+߭cf !wc!))oAf?ۺAJBJ>7PSEs@x|~ #*KbƜ$o.3?kA.p|,^ћg$ahA6[9wOH'% /B WQF/rIuQe(,T:{L>ə=jʓ92QUI ˼CǞ輪EI/|G?Cs愌lKߤRE=Mh*:U zA3Z'lݨ/WxG NZ7>T5K>kn%P4B0RLE[^1b(:3X`(yN1iW #.yk"xJO{XHt\wu)'KP,?uiS`n!DŽ yO[\'^=g FԾ?}ĊH_R*}/jrmk_ҡֵJI;p^XR n+u'{0_̫ɜ`>=qv4?6 #>eH909 <Y1q 4چ@YCl*Q@ 錕^BFF`%Qf0@O%#@NˑrD𸨖BŸcʔ$%B&ڐƶXeK {., TF r/Ȟ#.A]F kűn5hB@ ,yeu/UDAHDx^w) (^{x9} 8 (dt7WtOJqTw6  %J jtU~l J zBs (2(̅6Jl'fɃ34ih%uG@1(HC =2Lp7p7lmv™ }' Q#vm -y~ow~@r8mփ סϨ^ۜj|.@c'"g@>DZ=EU0iF%Ab("i]hb/s( j}(v>d>\3jJM!ʕJ:[DT>I#/;2#A' sͯm^mYK% =5Rþig?Sbӗm`,#gM,?&[zgx8CO`c^|ȱR2K)UaCwPiGHB)5C%}Z$M j+P>?YwY < 칟y0DcN&8?<—YUkYgHZ* [5%  R[[|5o qE8O#_}+:6́ZI$YDCc'ԑƞ}\LRXv.40d1^}߃@nlh*2xT!rnJrc˃q/4ԭQuk3G4˲ͪ8wy.3Ru-9K)rtl!gx r uos`՞Y{VY>wC:fF&|4$3zeg&_2d?^ħDiڬ?4Zg凩|·C[7%/-|cx{q&ZaOD>Jd IC+L]q9NwNlr37Q?_ީAMS_u]Tގ28 ӚDd;9p03~ - TͱjYZٔKw_񧻮Qu(t{~}ڋkkkj*t}GI9GD<-ԈJH@p:BYEU6wSH0dB;{[5U1bfeqgK$Zr>%ìj'|1#y*z|!O_ Fb3_3eI~$}Bݒw1]T_ZD?<ZowFjŠWN*Rs94e`]YbvivUV$,+ɒx}_~.^fC>R޲VIdnB3Btr0Vm -qS4RMbツ•U۷G:Vc9"M]s|G尟vyFMέD}_h<"ERK%Zso2(@/w/sXʳbYʪ\DCv `SAq0h-C[whCSE q B 33\d"֐8'Tޒ/[_ξ!f =(^?{4szNVYYp#.D?G^B!1JJ h UyI2vٯ>h˕ UWoZn;U~a324o p)`ҨUSFHg P_0v 2-Yy(SZBIz î}){,q +8 ɓnGxusɝ=KؓhuF¸h3A.ګ\#T i|kE ,"ҤUfJ?Vd&#LNֶZ [9- (c {d3#eӝB [ZIpNEl22"{Jvz!ڡ2DPc=A||g\}A_0Yn ojx_ e3]Vmcv߁~9Y*cA'xD+o Y k8zhMsr:q#SX#uqꝟ[aFLP6h 1rz}bfB&'2.~+ %Y,U}yb)W5k+qL12/@-uC`]M1UZoo`_@HZ`)O5cHjTnz*s@QCȠA!,]6(8L8@#-ؤ؆8ԳLo=@YSyNd/OAY<e8}{!b Pu޿ya]omkBQET{stUIOÐsIK?bPi*,DPS1Z}d4ӉߣL <oAbi2x]2lCsegTXST&L;uRӿK~@C<9 "9bgIm9P+ݰ]>l[Wc9j觩]E-u4U،g-'$" ThNĴ׿%}n4TOD*"c xT1?姟^-#,B 啉0X'GKX֩pV(aBQ7#R9.soN%H| 2>^2kYYT/á_AqTφI|4?c2vy*bsxd`5t*45PUI$fBs'GѸZ^CedF"otĄvW=3cIk3wRyEc Bˠ#:d`yHqK>au/jJ^|20xnx_c:؎.H?Hpl<[_'*9#J>e*FpXG9,.+RA8#gӥ1Ev@ۃ(Qn3csygڀV(@ElQ*Kmy*ؽL1ұt-b=ՒDZF\5ߝJCjI*\Qvoైܓ7.'G*xZ֡٣}>P3=6q-ظ}oB 9" C@ E 1R;),+q\m.(G5EԵ֩Z.)}!\ԩ1XPX`*nӉmfqz8)L (ԐD? ,^E2Kb,LEb}ˡ%`s~ \0PFO[D~Q3?UÖmwn ͷV0On/\K ϗ58PAEh$^FR oH'BB%v{rA9]~ۨN)3"2kr<۽uVT+i[WwWH$MX2ީ3gqqaoߵa]/XMn?g"qGv4D`Y7gS^砵Iͯm QdW1"|duXYԪ"yoY8k-&]=|U⹥*5(tgӚN ewRJYj瀝8ravF" nѲG] 2d"$2:T q?Mӯ xUk @X%>&1Om|Uz,~EF V?^I\oz$LJ䬷҅` DY.I(bGO+[V4!j"W):72_ BL0W{@T^)&5eh;]<ګMzY-G* öx9FnZIԞCuV$ }#x!1@tTb~V%^-*3Lٺ eX֭پ}hKKRKX\\/+G:0<[G ɤP"i#(`0Ghg$9>]vݨ>/! "ǴX^{mZ`*(Dҙ6]C^I͆Wj8HjlgԨA'};jP SxM}>cgk?va^@k+:eTDhH<,_8EPKu{!HgYXM%2`k׼Y/'=(z>"wbL)`d=gƇ̡d4ZA 5M?k&@bknΙéj" WMί^ [OqNkBc0DI@5ڠ0[/lxꐻRv^zʵr._uDd'TE}HWImd=Y#/e|xBAdk;gԋ87T6$F`7kuAk*&ȓA.Mb,2#=U\ ؾ؁@(A9soΩaqs,6edՌRZQeқ7ETЁvQۯNڶa@ |B!6 lC-gD4%u)AM`՜AĹu7M ?AGe17 ]|֒Rr$@lYqMiuk9 ;y.$׽[u W,3jk߈A%+_仔K€Q,_f*0}r}y(W6o=^&]:\FX$8MWnQkK["v`uKˉQ6-s`֌s2 i_2N # Bx("%-D8fkP7-6\4'>U42OCNS=eUYDo}Ɠñ*Rik+{;9vCh<>5AyY&SD| -> (өcAi#R&\-̐^t2P˚م1WsSX$xZg ޷Uɗ;!P0/}MF'MXUq]6:D} 'Y7O3ʪj/RQh -ZlI>.4fd`(B` Cax@.z4oN~_5B6c;F%,p73w::5tن.%Wc2$/BYqѷNEQjWp: nK` -jmgޢ#6q/בY,c8xeo~3p,ӾisVwy:W;/ BޥفVK:;g_ݞr缒BS=٬zvfuL$jH%,ͷ! pz3.!G Kd͸ ޯY+"rq*|x <- `f|~7_`7Yˇj)_;m*f'c5rWMr7Q&B1'l.qPTaP%v{02+(s6X U`#O+^mN%,Te'=Uq9I @uI[_َ&:c!Qq 3¾]`Ċw/ЛMxXvpT!uC]hM8k˰ ٍX_ܾ?誂zvЈpm(`l)I;4eUk;fu cMi5-wkMiA>EXZ8@gʒ%dve|>~ _ |HE"Bd1# P; 4*D"ပi"@NQe%P*n#p*k.۟qڗl қf TwHpRr7WbeLgO{i]" [o¯OL0ֿ{J F4AɃWu{v;I˳,7lzK6R=C3%k߷ Hw IwƾU*>5Oq9av:iU IRUz չRӨS՜v"i t ɏIPncH,~S6EK:;OLγ;vrakVYcXн6tR}䲵7. e(Dv/>-QU_=9h9*Q4eKx_J9C\hC UҋyT6!98_Ɏ}9M]^)u}: ٿܦ *_gixF?y/LQ=_2n5<=W /EtY͎_qeaЩcH~{xʨ̟ O>M@LT`%7Y@7Qu:@W/ukP.3Ru!A/q0V1 o\VQqƺǞӃ7: {lb.#Cu,IPJdzV'EM|^4@8qC2KwBRRb Tbe@|qy.}~U,,ǙuC#1}G"0u`еd q[r ρ.Pt#.=p*N0]I 2Ƿâ0Fz H 2YljkoOTm8bqAxz:5' V?@)^rI>j:pUKT#DMݒ2G v>6lLPJH$2/ DSᕔM21u05\<"0)g%ܩ[]d;^ISnl/ [nǁ~U7#v';۱բdWyڷ/9TJ@ڇs\II}tFqe \;=|%vqO^=$r 7wcx.!x*,6ۜ¶..2UdjK2?*) .8ߜK\btA-h o<^囱gmUDMcbnBߋj{h&5~\\ |QēԱWft)#/𒮱b|8 p 3 *0\Ku|}{@xJay7m8eF "%iO`}_қXK6$bm>Vn_= ;|h9#Azwx9NmKg&sśQY`u,<<ꮦG7yZ[;FReҳՑU${s LU{.ĸ m`lkn_bHC_eO'dkzsn䰎6UaQʎ&~[w7rkxpH: Â0qZ]sѓʴ5s3s̑@fk\g3*a]4?@n|* `]*@$G onir.2NSi`XUc'/k cs|(232M䀉G9`ZwUTt!E=3ZDKVOulGsg0]M8JlNĔ:by3WCz [X2IkY@ff.C*Fdƪa,,m21 9o\Je#cBzIډ?G#@,r3;WAPFXC|々:9ҒC9*aJW so@J}mCMp]!؆; (%]*?_me PMJTKZJ~589@ `k/ݤbr>~dA}5ߵR `<6= >+y؏7B(<&M7^똎TWл7%I׆\(DHC/a]`Mh\|17w^]dc M3Ɵ7Im{ka O&]H d}$$Puvm5@ TF6RjOWuOoU65ALgK~Ñg>>I4TtP]s.!kK@){ (f*-g@OJ8꫏Wa}@&Nb &H56&p⃖&Dk _MwI>]Žl̨~a} a2I{Irؕ<- ǯ?B4 YB_hKDΏmU԰^Hu3R+E6QM[0I+e6xQ,ڝ%5Rp @XYS3Pci[GcNkU v5W8P=}W#:P 6+B4R#9w7]hٻK3I-Eŏ&WT/5jo_!5rֈ~^{[\t{×odB /\E5>ϸ<ڳmu;M>Bt8k3&UY _q"A[V 3DZ91!}*7y!c6ZO+E }57EH@fd]@X-$Lac>lna<5M1rmhh 1Z^ ŭ&m1hC",Fa=lEb? 1mKq*UcU;IkpHyM`TD!,M!Q=Qu7h,Ks5eDкׯ Ȯĵa>)&T,c`ݺ*PT89pjGu+I#u8:CkX&-#Ȣ5Hf  #@~ ۘ?GclEL4FoFM0jw&ÒC睴<94p;U|DE8#yyNq|)) 8ּՇ{|NSw+x^QE\[TEόrVk>\Y/#^zIH#!p  0[{ĩ0"y4FT,oy?G;w]f[Nw]W8Ui%T\)e?OHq_E8vX +pzʽBeNFBFQS"=)"2ʛpwng+]͈w[mĎRO_Yqqj~B\..qw exPQ)ZDo r"ܒ?`7!{8݇nm#sr->84p3AxUWu~Ƿĵ93{L_3}ٚ0g Uk͵[`& &1q[) w^/Vr0B8""??CB꘹P ¯WWso>bOn~CR Al݆’N,/> #]L08J>6Ncl8ČP !8|7ksoܔlP@8zH,R&k!{m81w6 %n1] g ]uh $d2n]wv JZFfQ9.3!Fch_^@ OF[V.7?~ 񪥨K*Ym 41^\ ,vرeq<+duQL>u/}˹Q_#tpz@< m\xlL(eun]?ZOO d| }lLZ[HIx>.:%f\-9}=w}$J es"s*'ҮMeOp _TPfI':CY /DXFwqg^ne;ZYWԖI[`2'B&s o9u]eV%I1y<]hW6%8'BN徊zn]3I9’(`~uu _Z_dHqo.H9+@:$Ycd_Jp7jܱm QݧFAӵl\iq܄2ܘD¡z B2r%K2&+j]G 7k /xƢ@<>n[b5sW %Iӭ{N'%С!CY KXLgjc%yݝ//ݑpKX ɲnegвAy3_/XQoXMIrf G%n'PMUnUVQDW{ jzzIT*(>RNe bD?z REA8{w}ُ8F+S^:HF#nUP _i+\;#ѯ˼:XYZW_C$P˩ɕT[?}@ \91{D~ {-E |:>\IqkO%+~Z.b~}L_S`/ o!m#)><ݷ= t˼%zsVhq&Iԥ-Ka#jtF)wҫb&5i+هKa%(ɕC1I) +RJ(kUgZ Xw%.4+=^$h =r 41#9̄S)dz8ƈK5p[TҦgWTo42 xG ̦0uDek'SiWAvC+/@AvMh.O5!)LSvN1C1%ȋ_Q4PcWU:y[d4M!_:bܵ67_vu 7)p\VRkr[ n__| ABy04hGx|xIeiMG BTWndH?9/?U:=t!c,*SOyXtCFu+SHխ[eFwZ^\ԠF+F.6SN DwC͝}l@@ B3TaƱBy\ ,CYȊXSJ`Q7)ak&Jp$'}_[hG 7ڀ Kl1RJK&KMy|ܒ,h~_Q"47ڶ*8ĬYPc%\qfƟ^E}jo&b>w?s-ןd)u'6[> v ZV~^M5y #$F5o&K$`pY| V)SUA$5uFK٭oob~^Yf`[KqVr6`- 4#lGq7 l8|DV*[]oyX{l{>]f /Ր:i[,LR  {Xȶ_[cOToG@D%(`!aܕkeO-_(zYmu = 2䯃)w%\ieRF}v(jn/b4^.^t(jSߜSF043҈Dg#-}B2F$к:C P@s*i{UkoWqܨ ;te@uoQS &|sN&G]ZbWɧtC m#oU#XxNugtOak߲{T#',zлuIs}=uČ̿sVVtjyH\\ܼ})? 1R'7kw$=ԪYU#]ۦ3S({h=36x SX9߾4A zU~]|68q^ ZUv:-JSa /@ ~t{s}˄4 e伜Pa#eᭋDs DFA"pOpLT,VL!3D#*kh{&5 ^,\ MqwdSTV޹b,Բ# |#x 6^0# bA܀aՈM&5,ʺlͷ?*nIж2?xf^Jha,TDd V7Ӗ\X2a+ݶN~'ǼQ2R08kLcz\~M^F%7 jÿ -G g4ojgy!J.o !`+nu@ҕX^rfqNj;[\*ՃAH9й妝aHi󗮼\dL:!uz?+϶B5 aqjDaξ׸R+l{dt$woT&âUoGLECU:?,SjDfOuW}3[+e&09ޣح}?6d݈=ªimD.jgX68 rѴ Buϲ驩VewwuWKM~*lN=,c3Ob": @܉Ӭ{hX`4hZкgN9Wv"IMm*`)!"78֧Qd$ OCCW~Fc}Q.xENh.Dnyց]1,Q])Wl}_<a ~*b _rL5[f/"@ÎlpYr䐗|Lg'!ґ$#oB77&D M>+D1d,G%SwN 'A%SB(4E7@ tP"ϊy z:nNƕ]M;HZ7$So[t:=1*p?[a?Z;1yP㲁y'1d NSe%73lTK}ncƄ|" wo##7 @mZ3^ LiDGsƍ9GېCSac6?\<ԁQq ik, e,"J|'=*g%^W[O+f DN>2f.{pJʇC]|z$p'#f,O8wԳX {*}6(,\;ܺSn|z[zs~1*H\_? eӪZpI~͂d]'? -ȱ̂.lh}>$HƢOEG?~q5wZ-Q#XMhUlby1#;s/7b;{=<=õGOZCLxozYlAMB^?MPb"EKgqЅ>yLU>MSg_MƝW|m6 *EPUPTPhi- !Tr+gYxmZ5AaiDf]14i.M zϻDldUqhEE!sJ-=BӰ ,O4XL&>V$ƌ!\ [\jD.oq'~Y"Q |/w-y3pTQυA,BqGc緶G-;7Oט(>zdc| ['rwB?]ߜ&b>M{C75o5(/YiDe'wvDȭ Q};,Mg^Tp 2YB'$\Ġr&,}tVء!I!W :DXgFfׄ赩O-ϳ;KMf{ ԨCrG1$`]BXA:ׅ#bm$*P?vcj8g/Lo3Sf4,u =S?R8vߎ7W;1/])Y^Il e[s 4ԍ1 #Ւ`ZJ k= 78铍#`@BJm~ێL`AavvfxwVŭ^|Pr^뜩 *>I#E,;Vuƻ,畷&)L4K!/;E,dGKD3X,=mu"cf(""Qu K?ih͎@q%~ݟJbn `31du+қj6;]J[UΝ,oĐ rY!JF q#vc ۡr1X=D"IYrV,̴ }AA$!^Vin\) ,dm/@Ʉ5:Jym8@. YPBΤ7Čנ_~UV~Qu@ GH`zv}p׿RX,̛:\xl%2IUkLMXQ 5it f l#1d}>oRJ˔=)LēM#N lrx3   3XnR8Ú =Ɋ{36Wu ($u}4dVQ^\(LcLg3UGbh;ǥHAK9- L\d+?𺢤 JPD=c㯾ӽ7C.7+6ѵs)tk+4}6] j$XPi1µm;j6ma1!:i>4DSNѣ,(F3`\ @Ks.tBXqWzp@*V9ǽ)*#;I@"x9̺kTVةkl?,XYpLL.Ǵ{.\2.&Ah\%9sMwO{}y&+"GʲV{$(%aD?cI_~=3 z93S_Ս߲tU*J K>/ӊ_H0 f]6i}i;>4jm}^^G6y0&7jDjR/HdU Jw1 =C?IHK,0 3qmlC]zVBU_qqpN%e$ֶ,(~C.Ɍw6Mr`+I)YY-v-amF[/JB-:c,WGZ:×yd >d~_K 0PZ_ei0!0 G?B!).nU p(%RT)`r.LlwXA'ڃ]KyTY?vށr.hTU^3%>(H%/ B]UjGާ/go Ly|oK˓7?/\o=r ybfxsn#g/Y,K,YSaЇ/MkG.ph9-dBxGnTԜdhul;ɘk;&1 (zTA ( Ѷe;;C/ĽqK፭7ecx_W(aT[H L`F-, 11&%(R_'TT9'.GBpe?S hѽa204ĒࣥV4Mp1:D q<_=ǃ`D Fw}R/bdm-X[swqW:@Ό5xr2X&ӥAB'gyĶ)M*!kBBou(wz^@  BY( qKhy ")Cdc7#f8NbBKEݝ07g!k 3(Ze?>2vK*E:~ɹ3`a@fRr,m- U5'? t-atڑOp HԎQym6 %U/eG .9,>~taDl^\]_ȁ"zix Xy55wć;-aHi,Yt@(DHf(SJ}Oul~ο\q7=J_nw/dJ8 9N 'EHLSk9GO?A@`ңQQ8“iʹ=%%05*( mxpd,YͥŁq<ʔ'a\WkZ<#N©˩nv^4"`G Ăh=[hUk /O.b弄-L~$R5WRwiiH_as_Ruk;S,FM TH1T&>>y2|V1U?6$ݡݒn%QNn6N&㷣4tJ~2 ||?$=E'JФpW$=#^3Bv=1Et"0}:I&O],j?*5\U#Il5p!/L7뻙;f{#@p]p^Ӳ//2y__,~[a 0Yn~ۧ2C$X_-x.ūeM>DkEY":J(V@JR)3FPM҃$YQyl<6QF% OH9v&]zV;[({mž=_ͅ-wwWBPbLvG>%Wu r~XIGus_Ŧ׭Iq{֝x]O*>G+aq]?QM$(N7`Ӵ?:SO6|/zvw^{xSxXRvCɛ ASd "ap)M#*s)e6 *[7߫Qf' .s@&as)9G^bOlQU=k8q YPq ]Le^?c]'W;7"Ϯ#^0ϭOz*U$McESqUn/E5gCNxn#l
?qKj^;U`ѮW-f aevyxPU0IK5R#_ ^ V 4vP0w99ꨅhRJ$>*unlZ-iyv䢮̯ =" ^%gb~{C)?iE7#R/ $9ȅY3#N$OUsO;՜2=@H `PPdd%rŁTU HR.ARԥ *WZDjbtU ]'0,"۬n:TREP?*bUQ@bt1HE g1'M*O>#uPpznya{NHV!mj[B"qKb4566j{MK*fZҎlu;VS("v48M~ ݲBSg2vy\l?l`g-޿ԓ'&Ԇ!BhW l9lVȞĨ tfdD+kSJۃwKgtI#-ж[#7,k#;%" |Z{} oJ"p7Me'JBnsbK*0<r lxOe9{$4ht;B$!Ӝ﹩cH.6P @spcj{fF8X:-1աl{dyJZ-3  :dfE~j&@V2B 'n{7"SA~ @Ѽ` UBl Eq@PC1͔ʍJ/7 G@ eOp\g JG؈ӿkk@@*"lCSgruZCKO*=S_x"P=."Җ5 ):SfHJG$3D7U|55RMiO8ɠ%ֱU`[ (ڼ_g*\dJbTō@}5 k3[j%#8Mx^ @ؼIo1uS1>sYVRWt.$sӍs#i*E1t{6 ԣӒ{F`hk:ف)2v >-'iщ54% 3&ŁNyu&LrGrU]LGL̮v͆aQ^@wt?v"=W^OȐ.*-GI]2Y/.,0AL*c:i 3ݛ6MC&2x5-sPtw4M ؁"_.q-4CmnIb5~O(CbTԒU%r%?Kr&|\pEɲȁ_Sx&I8nYǗoOiki3-Db(+;J:g=W;Z]Rqr=*M$ܧ= ٣JȆbuFF4`f#hD[]nwgO?k.HVj)'^8mkI9[JdX;\E;MF;tRbEnZw12Rc[6 >S,0˯ 7\"S׸anY:VQR@0i+j=f}_&Hn޲J`c{ /V"F WšZl/ X.*ݯl3Do2]ɕu0$w84 uΛ@v֧-k7%˜kX!#[j}(y2j||R:K4Β4QݴeJ'86 R&8Ʉ̵_?y ?٬5M6&eL{"\í[m#+?4N e` S2u7)Uhn1jӳw/ݯ~ͻ xi1$= =H{CUWp,Yeo|i?*1D)v& Q`HXS$q'&&le/m]h(TmlK ?-onK!`˙O.b>2rҾ|]DqIs66,\9/AqvF̵>`3 F bU?N X#Yf[6ʶZV_]s}B-0 ˮ@]oD"'Aޗ%<]4%EX Uc[7q {)-s 1ָlRRTIc榯rSO̝|1R624 W(3M[jxSBWkѮo9+s+RYas`ɗ}2>t)-#!@ZQp4^# J0vSFs;*o]I#=z|*p>&9Ғ!>/]u'w={3MsRt1d2d)c^_ؠbB efb6|[m`Z>s :u 4ֵ̒m^b˦F[_M Vd+~98Huu`>Wi 9t$R4[?LmVLb;9mz.m&UOۿ5YL80kO>ܝŹH1R:qU[f'q Z.si =w (dWANi_㐛B!2=SqS" (Q@" $B 7 !%r 5*%VUi( W%E oIw0ѫDcV{!,ͧv,EZdb0rs7[+$_|e<;Y5rW,?I&0hA\ ٽ}hCj}Jx/)䁺Dn2A 1#mqbT-&k 3{^F,e :%W_BJGԝ=, T@# NG1VAGv;Q/m|']rn$FY*p2zǩ]p+ B77w b{oy_{qą2&)rfʓkU!>'SLC* uE0\~Y:3bDž xq8/򉏖s\wG0@y'~5E BdH/ ?ȱ0(8E]Ԍ5d\%mRQa ez)?` * WcJ ΝС Jҹݮd5h\G蠈v`-03c ]s&ki]k{; },J< C RO滀ċC:?ܳS4Sj)<1H.q^U6I8ͭ׷6pl7>R]|^3W(BF3áM'J"SAd;X)%R`a!+t~ d"*^nP`~3<.q)&7iV׃\BHf54bC̘>SڐPCk&y^.&BTl ۆ[>"gϣ*8,ُ}XͨDGSW: `|tIwk ;opsJ418VG,ɌgܫPV-{člw:98^ R:6|b+F;8;mZnƴ .b,*M QpkDZ߅̷OO957_a:àHV e^ g楥΁upɹZQR8q'7 H1YŴ`Đaեܯ>e{.GNZ.[&C\D;4ɸO 5l6aÄ'FC òUS>ZMFk8 0nS+/dwAOBL f;sj7nIAnl#lnao (ˡ]qRxs4Ůkkic*Sji 1U}G(dH %`8m:[k< TR+6- ~.$Dؒ]z&6-N<<)JW9A"gœ)ĦbQh~8EZ!*]0傝_Ix&kꡂUֺN}zӁ;G=CZ4 -fGcEPb!DD4-bbsٝQ^LÖL(mo*,%Gg"DI@U*`\ >4V\-6= Hje ;X([;H^2ŎaQ΂zwK`J eF=}UzoWFC͌"u&72Kn%KKn]$g2ivHmAy3*mWڐ2d;3yCK_,dA}SDvdeX?.(ߡdBJI'g^X2dz,`kмGl֑bE`⾕Ӣ+PYѯ)ƞU~R+J |KUA]t_2( ѿȊo5 _xP%h& u03O6$e~K_y[C ;?XyahKx;7`Ú ]m!WVs(бz& '1,3i;7Cex;)voBÐV`1|TQȐ1p,#cBiOܬ7[E&L?XsS:NO,g?Tu mN0BƂe[%rKڿe~_W:aQaYpeqZ9TaɏG/g/delNkܣ;} Jj3rȦ4v\Xq'Z7);hc !ɡ>F K&KEZC/LL?iO]-F\C ]BS*TNF Ra+(6ڄaU|0/ZM8ۓ8 5P>'h7MuZWed{ L:ByҦWFFcу> "n)|dF"XTՍ7Pd?+'[^/ qd7`xলq_-˶Ge{8|,) "3$3ldq#:[om!(T2-B0Hb^xn3u2 yT]f)̈́um9V`y;WS`Bq UCߨ?C4W,H6[Ϙ)AX p> ikvݘEfսDaYŗF&+fl^[ڍB:@}iYtR`ʠ0^PSRt'OSyfX^pO]!"X0,َMS"o->Ҕ=#LN駄͠Tq 3S LS7ϵGt Ϛq)g2LahZ)lc5chKz .aOyc1 `^ސe|ɸO 9 ؞:1Jv}*9{c]LOE3fҊJUm8SAbѺb3X"!X8,yC';u^1TjcH Qvi#apֆfEZg3~+Ll C ?Fӑonmā qP0ϙ1a1ƎdB^C^OBg-y SR6ޑ֧KHq@nY3 H0smZf$PqGtѴCOͱTFfhXꉬ$:} `u 6 o{)p ,&V2  ~Ed$qkI.5†WqPg'[%E[ȝ}3@-g%u' JԚf"e~CN$^L+"+y$ QW$Ű`벂]Ɖ blkH }mv8^Rլ돕mё+`PXx4s!FyE^+ )u;C0m.wA?zD.%T~k&D>ZhsNPFoa>`냨U(x|PdsZ!+1ìlY( EJsZ(VL 4/!BVfE8VEIN|7GE6d.`]izZ^]XS(6hM%{QavZplY['TKNp^4 $?ExA! 5 vr 6[.)3L0#%}jb~"\N؝NˆD)gv%k"o">QE.+`2OP`OdHcz>eIPD@V#E:+XSӫ x/=ЮrJC:#^unYo̢@Kd _t2,nc#騕o JQK/C)?/u)d/L6.y0kvo#x ?xvJů9\K܇:Je:)G0@\q3K*rH_P >8-)j?G"@בH0y|tc]AM'SE T$?٤FJKZCހ2\A. :ec{:|IȻLmfq[%#~yP>ŨXA(?(XVqB4z ݨ!m`۪6S]ٖg%:Ln#RQtбg à{7MN7Gxȋsa>{@DzCa@3X9*qi߁{Q;@~Rrn.9Y,Nn КSDd6+7s ,ǀH6Sm~p6:G XC $t)ߙTl9@$`0`bdGX=o_&d/t vh/ĉ[kB* ,-z{˜l[1{4ru%4c6Ewru~ÔEHcFJ-hhSםoMJi po+@ؒ?*<(m%{M,)6Vl+ljU#͖hqjZ6K_ZRV8 f73t,0SmOײLa &|ↄ2_s&=L9yt:DZMxQ fs1\pq5_#tȠEfrH*̝ iyez_ckbp| lFB""3KPHfg;IC.3Ǻ֘7v\؛P9A(\csIJKk(3T.?%U*+6)jaW5T?: M^ r#MD^!n; pt,vR `RfJo6[#s )9lf' 1Ql+67FNfk>`I=0uo囶 7ul攋0UO )%eE~H8 7kĆ|6L  ؚnT)*Qp@gT+ΗY`l[̖%e>A!6smˡUbԽׯ6yIÔ9L ,^)E'ZNO}Q68m6t+~5q%BJ~%sқsU{G-4ZO!mn˾*5ng0f?؞,kE+3+OxV s, @Qbeh-B [xH)t tgpYq~8hԋ_;*z ( @ dm]E[z 9VPܯh_.+d()݋oG`8s9?IH #Qx865܊'P6bcZ竻\·rAŅ_3֚`0|Vmc3uϲ`guUqg n2ڵAԦtVɗy:l䮨׷:dAX=Z,+1QKu}>x7zy +Mm؁ AJR?˄{Vot+nhr,w j/? ?q%z&2L ^roeYSU0;A:KƯ)En&^tn,@\,0ϿzPYAM = \lDB]&X~:=('0] 8pPH ҄'D:.M[ x4iL[\"d`Ԍ4jXZS>3`Vqj<_5c[všj/p&=h?h1?bޟ "k%,onUk%%7prveð^UW xћrVlawcn =KD Awn`-:~Zâ|WkH\O̊vimdIISa\`aa6[#LeM B[0>G-=>Y G ҉Dr+_/k+Qڿ|Ӄy3 yq]fU8LbsYFn.{0PIdm2zJ$gO8pJ{w|ubF¢wd_& < (n(^c&B&=jz"X[Rr$+@K͢dTԿbZ%m*ʛb%Sh )!9#D׿ à(u%Ggw{m@Ƿ:< '\}Xo+DP.U E쬁@2]`nm*Sk"s_CڏSN#(f}X=rp|\kM gCl`Zw2MJ=.7مy3d_ai~j|JhA3VƻR$3Ƣ0V{^;v&uuX^wfrҭ|W7wB/72nĉW:8Ifj"7\S~:9tTI~dO8>jv-i"'#?:hW~Ooj(d=(GgbO.LS& cGL2@EZ-jHZAm@<'_pj?aݠe!x~Ds?*2(;N~ gk=nӃ97vǏ:u9"`%k~)8MÞ]tg=LӑLd(!M&C<(HL;BE7Ts,FجaTHU3FQױ(2)RWDfc,-#w#4e 4O4j?0{1}I/?TH!Lѝ h>/@FM`Q8f ښU_!Fdz7wό摴SS7A^{պlIaVY.5}߁,(: zgrESo,R #\nfg`kxÜŗ)'XGH9Hfs$UztV@b&=Y ?";`2rAx'x@SY u;y{hFKұ6躐IIx6bVF9gqWk-zII=~CoW\mm?ckݪJ)o}E[o}Ӹv,‡Kd%4B讌b!`jYءyҿ?K1 |B";c1LE; jRdO F4-Ih9RDG݌ ,FkC K@.JBηuw<Ԅ*S]8JdӖկH\*-$OA’I31(Zoɣl{LJ4JׂOfDm<9 D$Hi^n-iuW@1 C 5JX 3yx YkGmlބkMA6V_IkWN^ɛ22sz^~@7~b?XǏ (uj=bOCҦx4WWa&ڎQy*dA7tҪ3ՠ0bM hŨ^$ٜOJy2lȁj;h}]rۃWGi {i[-w!c<++N龝& ӛR[;D^pv*.'7Zݱj5 <iŸj"TEX# /Da +i4Nom:%lpHXM )N 2Mbʹyjxv0 :(ս_`OO?b;7zb.u5ewEձnga_d Ҋ>JR*QiRAvJ6ʓ~ܥM:98T*>E89z 2nWdmB:*.Kul@CVĒᎨ; k#/iBCs)86fco!60 ~ƖR3_7~Y~}rI'g!]_[;HfaY'2m% Q|V,m[ZE=y-|&&4^rNgđÛ3"+1Sb3&OAV74PYK,fH RGœ/?#&Hpa?<07l{:t22/yQ*e]m7t=@ }~:t8!ls D4kUy1f;I(cZ=ߤR%u eΙ]2l."ҡnG;qˡ/ ZPb,\9KDȼ45Q w?p3 $7re<9rKX,M2/ :B6`??ĿwG' 5# wNj5uww4v՛ Ʃ!?7`=&wH@5/:.u$ S;lXSc5YZnGխO%=ε*??, QVEYfE`Y}ݵK 2~PVQc&H,nsmQ'_4JBu1($| k[tH10^E'FYsIwQ{3SLksẀEmK)FGCHzU,t`7$}ހNϮwR%NoEGtt?<$uOfJT@iqw}ҕ;D7r%tќ buDz9v'a_=.EA}z^3/Zc!.Ԗ{NNȉeZlYZGu:gQQlu(Q&cPjngK'sorK;B%osVfڤKH ؜F%oZI*f `qԈɂK6pdWs+°h jZZn|!syX#.nR%>J kz"97#_'v`՝mg"As,sRuj30f@̐."8zxgU1VŚK awmǍ7?FGg}Ѩ~Gp3\BR }#:+}->$ռda[VOY&I{ɚxe+j(BV2ޝ;Urynz̭A}϶0\QG|k%KZYw sU$rfoWM<ͮ ]r3D$(j8KM](ޘݡWW 5܌"*o <ivZƚC/j2yQ 6pr+cB"\|TY`7O#+5dkUf殪Al.ǰl >ܤ%k]{PSqyer$̂#XA6 Tz۟NU# #@1@8E .vB+XlRˋ:xyv HmM^A1 ]g%,yK%|f4 %'j w mD~ϣND͒360 tutk~5g XrEvժ}dho  gŴL7⻄_XWUaAr' |( QQ<綱|V>>V,}@L-㞕I Ҁ_{c9mK]D"udu[2cɰ#ٱLY%.,[3%zTaU:0 *%f; 10ƚʭ{gDǶTb ZSg/Db'O3pO!ͨiW| ` b(Z{__cc V^GY!xp[ZRs;o¶LKd "^y[XaٜrL]A.,nh+yqXFV[;&%/B~e1$xkx`:LL bx }lWPw90^ J2L6OɆ`"K0LQF$y=~gUvSt@~_e*dzR,< ,B-Ta.C0WF(g.X_ )T9BQ9"W]A(}q-8VGcu*E8a4jAzyf"wo\>ž miSbwA! `S&byIӊұ ࢟$Q..v"Z`X^xAt^$ź(^DT ýZ{&zUs`D4ӤݰH0hcVG=SmS|tc%ג&^.}7 0?I+GcZlnX1Nܤ/qiyrzfCfLAbE)s<ìH. H)OA7x~FֹoIzuB VQgAϞPi@yӸ܆Rh\q1 8:!MNf߶3B9Bm CRy{` &TxGm)B[oD FXqt.^30fw[nfi8F[ˀOHlʡ֬F]gϴHܙ,ij [OTV1mB~a]Tvel 0@ȩ܄-6Eo0GZrWcuZR7f F$6DU)4Pq EP;58B)!fT]iBo&Wx*xl{D+"c֎t>P;Sojbm}Q`^aDE@ZPZLB'ʂ6 XNVn\ p O1JN()!(W1E1 hd) "* ty3mU|[8O[Gl$&hrs (r S⻂;I^w֕G GHnݩ&jINм )[';B2nBv!BEA,)[W'LWI_"TU]ECr3==cbR#CaD_"#'z {([J/6誷=z`Nqj@~8UPermA#feUOLb}_]#!.l"x# jNֶ%('Sc-5yQj4TiLp F]H]R E7>.U(%9Ͱɪ@5qCW2O9Z-gȐu@+cHd83oŨ/=lo74oKaOJxT5dmwY3M碝GQ9j7ظL3/쭇l;$Y6r< i{nKzYG;&co{'>8se> LKǮIW7SqaiC#7Cl=Fw][|!Puk..02,))GÒZGæeCa #?gҒ jJ< e3d:QpQQc̹"j+,LA╣f芢M%q!F]"2ONh%#A! ֚(#a-=B- SH; 2}ءtZN#S+L vI%9o5QVAvWݑo4hȱ?aFpde!`_Q*QmktE/R5]l٪SIa#X?BS- VT/j‚)t.5 /+8TjZZGK&fBՊb~xE(kċk'Q6յ aeU}yJ|a?w~2E78L;@>1͘E#\a7Bψ sQ^By"-~{s=ݤRce˶+r>%bd`t0a?Բ?Ki_;K7)QفUf1/yR6Ymןz+²:" %u75'l5 c1~),ڛֺX0z^j9]/={zňJ 0sD!~mB2P5ZOt]6I tcun=V䒲 p:e5A/FFMJh&N^!#x^kRJ^NظD= [͋͒\"wcټySP909{ cad!vE柿gu$[kz瞾Iɬ>76PaHUEFa>ǝv^-u2)n ˔0 g(}ﰳ>[ZcP3\g@Tj-jX~ag0 &ZJ+X,V_!Of2L+. k^oᘚ3 O֩owY04-zhd3 8-QowqDiҐJ̆, kzW s4+GÎ=C$M-pG4Yg`yYKLET rr~Æζy`~@hꍟ=ʋx x%L\w_-caX-ԗqQDBf | ت0;QGLm^#SI(lZa3sRu;_Lh߽_['xcAMoDQn'nX)0F7-*$HĬ*UY)  я1EL _fVz3lWi%8$@OPNtuWE;f~[EuI('+x&Ybg~Q#ɥW?&q G֝g]ICSeu `pQ֧E-f~e8" " y5:^'oUT>h cI/UʖK#e+^Gr_d ngO6rx4Z fX 7e]ՃR`˸ŒyP2\LElOk7 MZOըmI^*[MZf.[g$ ..ގ<=$B #߂!48M 3Q^{\گT0pE±zUl0螝6);OW"\6:s/ >k6 > F)ak`'M-[Vj"c*֜J3L!ʠZ="өk^.LDZEX[TG]⢾ȯ.(8:w]XK_ =l Y9N\wՉ*Nla;@Dm/K6pB.hZɗ*^\:pȴ=*[:h8vsD"L j2kp~R?4mƥq@~d<X ե˟mXߜY|15・z.aP"^ 5"`&ޤ SAśuSQ'4;c~N$!4+{ n%Jgv%t.ƌ s5"v`t*@̽aT1* 7fi%BĆ="qf[ )z(EI;{ bp׵)5*|1RU0i(Ձ`?&, SQ5\g&*}$1/>c0WfAP;vf _V4AdP焢zgz- ђA֏\#vPg{%+:XLis)[6| 'P("! o?NOlZMbQStdB_}`X T53"o(V-e38aTHeJ_e-"`* )eħ@F~,]"E*1̬'Z8?YLBqzmV!t@K3R<߄|EI٨ gH}sIt',{8c&p`'eѷX+4rkS[S_Kd 0':*Ȧ[+w}F:DK*YsqCmx#Ҝs]wJ8Y%Gb]K.ňȹX$M!oLc>[5h'U rwcZ %A:ځTxIh ef؉  Vt|D[-Ivz @Fe~&n8 &/mBi2`QA۷k EJq^4_iOcꥇD/UrR#EzܛBd݈MĞ`0Ij>T\ E-=dT (5lZ?Wh8G/maN(%J,Տ~N+Fm~5{Lĥv/YKr,(X~MN>tMԝU"_ %׾j (ӳ.BamӼkJW$h̠O`AJXWKMvi H.OSv-M(b2T KtRfU>MRnV)0QdPݝ.֛ƥU}J:Z5G>q4)itX7McP18eW\V iV-iSC/'氝m)qB5BSkBwqj=J<[pTk3>e]DZĂ< 3IkIVDcؤv-,_ *kTmԟÓ](GAB0q,0Tǻ䥝=cѓPQ9N̩6LTd_RaHMr; fNB}-8o1Q~a={(%_zXQKA[k~]qrrꢑ<ޑ٘d"5uEHɹ˓ftChDғu>neu vMC b?uFZg7+"\T#zjyF<+ mjbzLǍpD̒?yD}RoG"O9r- Jo5 >sq/TSbۭmAP[^A 헏PXcubո fNK(EXǑY`T!zt6,N<?ki2@XM ᗮb~˩w C@T͇ ^J_ Q3 ?5' ,lt7ujs1 @=M#pIܭtpG:k(ϼ]M &\_ ]!R;J Ol=翭4)s8dR 17Ax%Sb:ӲŦf /7%':]]Q[D rvwρfvW->J7cbb_mY0>raִUDۢ R{QJhy>.Iy5’$p1hVy{8޼f5S >vFlSwVMa88_(Z ,WTbO(0qq#PjQm7'H4vJl=[ "o6Dg.` 蟪%UVP;)Sq0Cg/S+2# EwS_`gl9*1?-[p`ӯ_¹yzӊ1UQlJax 95IzP_ZUO%9fKk1_H , =;i.ADYpXhxYp: $#Q^Ƙ;}װv&wr z="9hŠ8 fB̑0^ h2bｍ9S / { JOH[HV)Z#I |prH~l%ۢ+ZIjEjwr5<`|@OX^CB@[ 񲪹V *dp{ fNg>lsMwRprt{3e+afJɤg|Hb-Ѫo<숄 TQ&#f(1Aa*9nqmFUl_改sI26|\cB@y#z<Am"7/9*Քh-" BZ*xgԀ'C=?N@p<[O n UCɩ?JPlxl[U]#cq ky43B{ˇwavb%1lm%e*`SUd2 9g82h\3;”9Qt$:1gY*{f%[d@O ^ۏX070 ?"ϳ^LLX~9^/ˬ 'huȭ6=QGaI'}ŻnE5VςqЫ^ ca>xu8ö0;ɼ#J' r5ƴ)rڃw?3.#ҏ[ m" Rx=r膹YN~;-}fD^:0#)"S7UD2y$I$?bV)DX܍ړ N`*y,:[? qmY כfQ -$oI+5 -cbe^.|L8j/JFfz&m<4C38X/yTNHvpbB&%bߵp6Ik dhV^GcH֓?j臈:ndJ=Uť];z鿤A]aaP張C.m.K a٤@F 1ͺA]hj& ߲ꊌ#2|%TmD@L4Sܓ,/y'Qc:i}W@ |kL_ C-wKhPJ} xTZFiuP0 'P_'̋LH—h9-.v_B!^ XeoVeբb8uɕ22jT$>f+ ːXӤƁ pO0L[yLفkS ^ٱ٫%o=݌* f XNϡ?10^ZGֵqMszXSf~Y$K[Q;SeU}@!ʵz'Ѡ!լ~H$@}X ]yL/ ty56;L_݊Ht-SK(7lQ733~l7_Y2>-I-DJMnnǨ`D1N%)AD&[ׅ"$1_ zPH̴fz+-,ɒ+u8p82?/Sf$bn'柆@k%*19쥀z`xЋbױX ޷xB0o8.Q0/x5=N$mdync(Nk~YF=/N-8B]YEMpPR֣B\a\C 8߱4ύkGֶuh7;lH2~*ya/,<@=0nzMW΁|y٘R5pZgC5Q\Ҿ5AꣾnY曹orICPLШ^LF!`+-`j^*{3莠@6ˬ(hLw#I #IեY'Qc\+S):KF$-D՘a_bš$s; .)mPnhu<~c=Bն*˾)4Eme/^/@y}]g[]Y6<,&'AY m065Ra8ɿJGiH8ںrX@TIꑮ-KO].i H_hQIf  W8N{{z`G 3kjVHk V|<\@BPU6wW4Oq(8EB->^ʲ\"pHԴs6x B<ټ>lo9dz9bZ(?樓jI,`3LaCV0Eq{ 砂9gOD*czޭ=*&(iƒU `/W<ՉV XbJ84Vٻ7$qaը2b^7֍9֟*!𺍈$íh(I?A(v;x̵^Lc 80pQ+S4GOZY0} þtxlAlF1u1cR @(HSm^SNK Bb`Z$Fѷ#)pbOըU_t;Вc6ِ*Fx!,į+@)Џ!ĝaa>f)ňә5~Ry &3)֨ 2ENw|s6/jјb2_M)W0q,S NG0NVd؇ff@?OK;L!¨ℑBx>ӝmKa8?'—E Jݯ11t&fP^@"SnXxǦ# .#SWMn. 4Q/I?גO, _ж yhx ieYOadҵ?xTaS$0y1x5~a&B\W[::fNo 5ѧaAqhS/F%^ MQB|}MrKYYvv$R,3?D(>ЯA H|o*+R#3Tl(iwn!ްPNɷ,CuZ`ƞ]6%16%8ϟ%FB>h@-txkPwsPF2_E_lc6; '&---hrˑ:\j޷NPL9Xtk :x|42Tlw.sYDO #-}Mw% ` *7q ɫxO ia._[Žߋpa娮}tϗr {KQ}]\ |UzE]F.Ż1FAVs&p( AJeh ^mgfS{aNF D£ ͤf9g轗겓5bѤ`x&}jSZd@6_?+ݟ41$^|*oPbڏD=}J2RB“18bDa0f;.;hL_^y#XG:唆DuYL=$ymeJDW^~7@M;)YڦW!$z 'Ohq k]'cJ q4}.>ˌ?}PfYR]S^;54o> 4r#6 Br[y8a JWP75tp#Rx%1휵j(41k8POPڿ-FEoy>:,f6P 0"B;ܯfRm?@^׾0զwZkxV >&DHC&u>mIVB5θz7k $DJRcx57ץs LW6R$nCZĵh _vG.zYhz{94] GTQ'e'n| WbgRQWgAk5~'K"f $̜٘o$, 5TU c7Xu,dH C %a!LR\FfEs45i,hvF‡}ra)}rԱB[t%`i"}kB-ߢUj;$pmt/QYJ9-qQ zS!2ZJ՛ BO<'^cFNED}hdNr #rb⟵D%O,:ǫS<`x)3eOOxE=`mUal⌝"Yd1f(n8%{L[΁bJ1dAm0k[~_J^dw:~<;1k( $$#BNe쫺g(tTro9t Uڒg:1[yڏѫj ɨd=,Gט2gJGKrɚTw\Oz6%V8 yQ4C(mu:gؗ$ r戽_i7Cy [^nGaޮKzd-FfV{#g ך u=w9P脊YR} PSy3;m+ΜP~hTSm:KB9fZ07-"0,*ʅH޲[c$p~uiD{?/uDTR͸>}uҤmp j#f#(EQfM *_4.[}?aM\ gqXOzJ$XR Ww <" PB܅o- m{a0N؋{C>_Y|&`Ⱥj3>;vTMepc"I +nQ-q4q~>uNm>0z⸥[Dhili]J'--yė%Ha=QEç՚G')&㒹3ߑcyݖY0\oS"yb/m[|z>蜢$U8>{PߚlJ!JF"(l'Pݓʪ`2c1Uf 8;Yaia1o`u@aOUy?S2FNA/SK]L!NOz;n$-p`t)ٌ,]1 W7h_WEuuם)쳂~|M߮GM^.f犚d"^ix㙾e=\nAѭWFX"!C6yV-J0-& L7*t:9 }kwOe8ͨBRyB޻>g;C9cqquV}@N`رPh niAA@(s[4!aTq^;D)-3T+)GOY>)nI9[i-?a\ӷ|,տA܄dOF-<%R]('c ~b A:AZ{n.g6k[i*pmggG9A;6-H\@ZU4T{ں#]uasjfi,9[Dر>+edDa:,V,$ ԥ0is(BVdVSxbЧ(c01䐆V0Y Ή!iCou@m)1}-TQ[=,M)!1|h.-k*x;B2$n2C4J 55Ӈ\~RQ$rH\;% mR)s9{2=D9]aOL@-DF=!d/z4rr+j~ 7U5䒲RIyݾ|Z!dXީ7tODҽrY}nvS(n~o)EA =Ui ڮ\Ԓ.tOa RKt}%- *ZV)ϲ<1{6bۜv '~Ѱ@~#>=#^GI(TkmYіLUF(PJ #c s׌lD cn^[c."s2s<\"載Se}(rlV3&W"0t!V -rVr~%FKC{ue4 *w7=IfK׮ s"_ HC c=оXfJ$ןR.6E%&,'O)$ Kaxk jاCZ媜!S(\ m2FPFykd>?K;K8?X_r9 (cu=2޴ݑwB<AQ6i|$ kPoK,J@qzX {og:|y2KCKg5n;C czuE[vXU:iZ o?gRvWlyd?Cs=Md7{Q1"OK=FzfZo.kD c<RN/7uQbRPBZ6k7t)>4+u*~eWԪ':lmʺ{T]@4O-Z널Źa43,_t8=} x2Ź ^h?K`ଌC&Zȉ.gM6ԡətAaVLJ=(=t(tl`{BVtn<ȑ,oS]E{wTtL- 1nl"v%, ܡ l6Í-;;DBĪ/#ia،]E/)˾&`=Qmbխ% j{(}*?vvM"NtwF<iG'piN;=ȇ!b熎TEInꇶD ÓPP,Be+?ַGxVB5M}R0v1kJ NпKZ.i3m-?\il(=K}ta]R7t\G~oG>̊~rǚy4=cN)J0ga*3k (qE@4D W /`(:nHyf Fe9Sef-P!sz)ea3O@( d#"2&'|+ͼN`™Z$ĦÔ#3S*Zr َ|Lbʏm ?/ȾoY؎(A9Z.ׅ3lwUzA 4db;Y!\ⱋ@e*dr8.Jr8Pn1C}$r8Hm fL. Q;;OWYM$^e`_!sh|C<Й=#vD+%ϢI}KJ_>iAiۆU_Qw/FK'ɯ$`rCƋC>w9ЇQ)yNӳǸ@j-۱V<+xކ@g䕶%] rwmA_\ ;ɶ*2W:Zp!,Ջt S띎S m"1{,imvv6ngKCȴ3ٯ.)+xտ3P9lLQ$JVߔش <\rM[$]ݞ:UX,J,;d뵉[JlaQ5?>=mXaEēe`߃a>m;slV '6lf|1pO+y mٗ+uiHjoS5{itjԏ%/%pw+ē*R $;aOIo@d{3h&ۂ׻? >my-5t\moӦDZzRS:*K6(1e@:. -*4SS6pr$,%.]Ħk#h/XAn( ŠS#t/4MZ#HgwDШ$Ekn8)PBJ)%ِ^JnSC* 8HEHPWVEqC?fcqJ5a\Q>&*PbHOq$DR+݊o s2 0nX+AՔ "C}ᆼ^>D.hqPo y^EwH*|ͦ7E@M.ɯX`veoH2||) х\48Vխɐ"yBy, c߉\=xq;fknT8g&ޮyGZCof/~nh SIN ͈'Z0ńB@Bٮvci=qMA/uj.RJy=/ AjBܿ=dG6Ə˙49{< ^6%˶QoZ>yKiT=dO+ݤc> x]ZtˈK^#[6B\Ū; ى_t:Xη#$1 U2O}aOo4GA=!!>@}I(-Pa9`p d=NO^va?,\t!H ?/9Z<*= Q;C\d2@{yEۑ10! ]I{t;kO[+NK#fyqjS_ _[z <I[9w_4QAE{zC@NVC!\i/]0LE >[ukk|>ժRJ,!L =T:c)alHנYG]08X [}V:h=Fhd 2߉E$ly$YG!wL}= Unub8g+Bo3Jɤ=*5ZS4=H 39؊_`7MG!/_'>Яjj 3u=_ ՞U=Eq8Y+<_h}{з\ʡ;-X| FQoRlqك8pFkvJ'| yHa[^({l/O1g0um)8+-Rw8g!&GV9X=lvvzH]Ƭ yNWAc=x oM|Vo L--w M ZKq*!)nRiKns^M2:g @X? THuh"oʴ[N np}I#|2q6`*Q6 E5h",5wF+mɴMbCŀ;o-/|M#n]Iy&͊J&.'@uvosy'f5$WC$EZ&˦^R4t4ڊ{VfU55vDaHzw꾞舼 s62f6m?tV7u]F Y,+g͙^uOM`+ZϯRB)tce1" Ӻ0]pN t Tb g .,x~`*;t - mbZ>z&m"s6@oKK3+=mA#,=V4 U>1tO+D gy!Ept4227}U` E "[f۳OA]ý)ݑh|Edw#5sVK/nnZ%mgْ0k|YӺWJE?mp^ga_M2_'8* ZL'= `8a1_]T&BOH nRC5.ك gy}5-ѬXjjͿ ;Ba%g+zYjI9pTήB"cI<:OFS-KvF KJ"u<{ 8Gn zjbl"oC,- v۝UuX5K$NCV<ғ",v8ލ-6acxUy SឋǓ_= w';؃/|Ob!{Yl>i۰<W$,@D_64S+T;_r` ,^ U329nB#Y*ie jЕ͏+#5V<jb.~{Tz/zBcLIb_Iܷ*pA\QQ<1h(ձaVJM & l!INjb D*(/rQ,j{)OoXVwF J)B]iJVud8x>o`HHxslI*L:^ݢ%,xD3vQ ˨j޲2#֎y#&zKSht٧jomxn\13ƵyM -V 0`& D}""P6wy[k{CuS9ηȫJN5;Z;7l^~D6gvaB$w2˘9õS" > ԿUѦ -[ }{=*(hu |O̍ͤ;51ulX0 DːpyvV#j`Er_^kI5bܪ='XE$ۅ=Qrq~+*޳ҎrzuS{ޥ ȇ oK?h`~vI\\4iyJruY$m"NK+(vdkP6(#Kʮ^+g tqʬ!DW0g3  gNV/ Xh:@Xۻ颗g@h}rhk:ɝcӯo厡<}ӂwvCQ6.D!N}<혹1/eۑUW\L}|/;.f.v{ 3uziV; AS*Vns>0RÅPG1J?LJ{X aOM6*!0fY ]C=h ^ŠսAb W0@10!\Rbfvj}51Ȯ1xcqw%/K@9>[Z5GPfn>%#寯EsݯⓇ铇k}u< mm ׵e6!$;u+"r:edHY=`t, a$#9-Tso΅-.o`kY!S3)xb`M P:(ج2sOv`AIW%^Y[CBg0}3JcmNi> mYgy{4^*X zILWEnOh On0K?ĬD%ng ;-Z< wo:,?[RAfMÊuO<[ꥺ@jah{p =I~q`҄CqpPJG, ?tG yo6>W@Q)2 u㬏y*3f& mVyHՅe4'8[tN7`sjFytc9M:cjmcfyCBrl±$xUѫlUZ6:Xy˷DQXܩ_y!} -X-NnF$k?IyD֒] \å ղ`#5Oފ"IZ0mtň,ab?ea3wϜЋQɖi(1UjA$wk]sj aFeYz vX٫1ik8)M*X+U鉿_ox`b@'Aއq!N 5g40ILp3f:ةVb5]R6ЄOb1Lkϋ?cОa&fWamRU*45qDzg-ܐ~4G^,IDoQԷ޿- y;zjv֣strNZ1i?k=#kĔ'fޒ}/au%->Yi~|٪LO1 @7FLo8l̻ӫ[C1 f:s}p+0&WՁ#l+DfS.)^=,>Nz+:ZnqV 1%K; w_.?3FCIg#a>>ZG%P/7&ZvR uCʹ jnGɱ鎢g 9jwYPre m_a|![[\Oq\藀NYE K[4 c LA+gBE:WTD!ajF bqrBP|Q.4;#qp|ʑ6;+ BThH i|Ӑ-jeHWg̚EM5zq,d=XiR#\0`rmA!+ߝ$A˕*jF3TB V(nZ[刾'`(*6{oy5Qc8kq[eA7p,!pH.`jCYhoJF3Mϼiꍺ'˥9 vK>BL3 K:lVXn$`_g{S1b);@V* ~Qw_wC۲̞[D8"-u$cpBZ.:ޖH1"uQ<2"RG75+gs9Gy`xYkN;9-kJA8wB[|6%/ϑtHÐU]k=uՓF qoH"`$?ԲBNOT^*3&݇ .[^K}H,Ì^lTev_C]%>Ι&pm>l }wkAS죍'=TlueLύK㼰 Χː"G-ϩQXf3G%&ˤAAT5[Gs"qP1ڶ"U*xșpWuU2?Кvo#P7M"t5}k.Rk'kԙ( BZ~=֎FIzT-o>5 t!9_kDE^$KE dBr6Oԫ#(MIjlNQL'|FTbҘ7.DZn`jb x@-%RF>[zȏ983~!i YZz-ʭ(nʣNNǡp;0"( :)~KNX|t=z"]%qfA_Z E ^f=L//!ضLmR [MǽV߻%}g Tݮ-2=D^~ЉA7!YU~( :< Nr~d0\E!W[[ m_ Hؽ!%A⇨tC*sYpvN&$Jr"U#n*'Z,l&e~8< YQ L:5z"q.+fZǓ{`ݝbczL7ӑd{k:|@3`N#l罃XL:-vr58 /n֐ ?1$bMH<-G.UߕdvZB?2J|\drel;uDguS)37ۻ`|!͚]g̚R-jIxR 0`'T2bnx#~!ڌVηuP"%'FnTJuxu"R2r"Cosbڙp-i 3^VI:9rכVª.יW őC:d~IB u6r`MCZ^|"IU#|@0~^ bI@*SB>܂.ɰ0a;UMڼ]|&Iٔ?¶.QL*KZҷrIɞ*yT0Ǵ g[#ՆKX_._CGdbW3t׉Z-F #Mv*|%vHL3|QVz}D d;[WizeuQuT3cKgcQ{i&{V_]dEAe q}Bh+?=|` ޛMVQ{e#a W-+G|2+>-j:$3 p4 l%2;.%toeWCD "-NMr=Ƌs !7F.;?Di SX̓94p(&ޢ@;I+l|=tsnk-dwMqU^; y¶ky {=XxFݎ*I C5 H=IcK/7=JECE7Z HD7p!1K9RgHSU% g;CB%>/66enc7~Zvb*:_?oik@C{1Ieic)ÙݑಪJ n+{9z]&Δ؉,-_@8.戏$\%0tHNܡi`h'}%u֒=(!7ۥqFX&Ecff7q.Ke%vڤGyVIksTG/%Ǵunx 7lmKT /4N h3&R,BbčW.YP+SӕZRs yM v!EɐvJv}j#t,°F׷)q0oM\Z+N=nI7s3_)Q6XW)x,I'%H{>|.14qasl]qS@urVSY4ԋWNwcoH纅pc(’ɨJ:C?x!FnƠ H *kT5 {GN&Gi2N8\oJөd }G% 't~qpY@h4Ȇ][=sK+{cY|!ȹxP] Q+{h.jbk#4Q?YL}hTD^\G:5 ?τ-GPMϷm[DHP=r/Y]ώ݆7CF!t >z nxR0< 6)EOWE+Aj'RJr']仪ĢQt3-su&DeWCw(B@ m>Lxauznň:#J CB};_>&Hq{Ti fxcl9r3%CTr~CkjnH:c\`d{vz!7T(r-&i܍x5Gqԅ_vp#-sUj|E#ěNxS8hJJmج})Gh\ޙN|jy97r._QSuuhuD96/xtA_k?MfoRu5EžDgϖDG%g6+-?Ya>o~;V Ɗ`Pq]a"TоHzup:z9Ÿ[`]-2&qo1ċ2?1jta}!Hᑣ6by"12+%ϋ$D)/Y?>q*zFAnvo+lE=*UC T;wwY8~?.-yLϔJ)Qa]S uAi^IVOD\Y85[ۏCF+TA>ON'dk _6kƹw>`W (b9{`6ai搰uW]D6b*&#q|snj˙'Tƅi4u$_!C:m=AG/,eȌrCk+3"8<èɌ0:kSyȒC[z,eǚ*r֌M :n"Us!{߅M(=$5ڪǬIk }A;L׍;{֟%ڸ{QZ1lX*@+OL4pr/M!4A}*vR1֕UAqSC!ybpE-Hd5q4x#ݽ(lM4z]}>HRme'_V1_O3 +lc42:ڹyQyd[9%67?U6ԯұN{(Cu@P=v=*Zn-妱"wMKĹ[#vh"Elu:ۓGM{h S`ւ%7Iu痭x. ]7;iqYv ݕMF<Ec](ɉFY9vDɣuMDK&Uad̸:˥eHR4n -5G'q52}J2a"Mkբ|%.(`}A# O{9R]Pοu@&u7&wfΕ['P8ۧ{w$+<6ё$}2 e-;TDA^8L[eDdp[]/m0H(ĖYy\̈́ PXEwL:>M;#(0\hԾONy.r=QKERe5P=|E8]/{ 5FwNeD!ue {ȺԚljXή!^mi{:xbPO߰9Vy_XwyTg]m1[hESuDSL '+D a 8a"!rKB[E+f.fܿ_>&HE;Ͱ0 y j#dBP AUr ”ofK!T=5Wn[iOgŬ{2tY6{ne\r{ٵm5͉t?X)uƲӜqL"K#6zv\ ~ yVg)XZ~cш]je"qj)(Oׅ\s& Jc7,^g5sܝ/&egːSʀ]6u@+Xpr:Fi_ښ3 `7Db/N^a.*n7Z i2[ԮB#߻ cn34ȳͅU1 C6DBT` 6 gGY,Bp2DZH%<M.u;pE:*X{ׄkUSo.jKm@~Z@w3y*^=f\ںkО(0(mC,Y$5Rх!ۀ:ܘ)P1aZ&ϊM/V_L.)ObV Cnw0xB̛leWkX }\/՟̘+@Jck/̵!?aPYu}re~N#iziM8H_y@X7̴C1ϣ?8#r6.)1zm8In9e;#jt%"+W cY1юU|h L`JM?XB>_Vog~2Ϻb s|pb/3F8mdb14{ Nudc+ !C"N/paZImeZjl {aУ(9w30 7\C<%ڌʥC"^4yq jBd\N> zD+↋PCU Vc!z(WJ:gQ yC:][XmWmFQږ|((y5lj]#bWG_N;wCe}&hWof"BM$ @K Ct&m,lZslX=]Iأ MhmVjShre)\Hs8}t=xUgۧ٩M~SN}G25p\8P(Uf[qa1֞<9,I l j?qʪ` A:pZ࿇VY?j94H+ſz۱&IJ)[T:>+d/uuCvDz,!d"~[ Ld Dir 0LPRh MvBwIP% pVCGF@6RYR;-Kj ucMD+9f!r6|8ޛw2Y)}`'95A#z""z'[Ÿ$:V TuWȭ^TCɦSyElS)@6n.I@ҬrHG9dٷW=>g`G*03MqExmC4sHM]IY1.Ee#w +dƭphpK{O?c;- !=OSw : P׀6 XlsMYVf=읒}ZM*<߉j?\43HIusHk,ܚuT@ $\1.\+ 96۱N68(JŜa8ec(?gʧCIf'Q9 5,bN ύ׆@?( /f$n&Z{׳L_6yslLkP$8͂mk'Gee7gÑN˄9Vvc\۔$=`EK8ҭ~hnɀ1KJ,3g\~˓~|*a&W} ^{| з_"BǑ"?o՜X|謫RZ<9()17Ef=1minLpX]ZљR2e<̑>׼ lyuAptIk<ݍaylQD#Pۦ(k3UE+MkgϰvhZE }$Hy@udgz޳FE_5ӂ-A| l:}.)Ϩ$nI`/&E埆mh0Nle/ȴTsp|D܂ck3BX:bs Ύn! IkS"|"8쩗g?M4a-0c/Oל[L-پ7>_N*Kǟht S@~g|K$}buG,!w'"+v >q$6>$C̳}Mvϱ¦ @lgu-,qJqYzMǜ,n߉19O&~^4ҨFxT˷ײ$p D'ppԆ.Irq5LBsSBNsX2 DhC΀J4!$d0_E֟8vXCzy'P#=Ӂ+O Eg|"&Np W\)&%s4X59ܖ xY#`|,ҿ^CҊ´AO4B<5%:|e8KYcR^ZWbz/Mm\ TxFor64 N$sn2~O / 8m8kh~-~m)oݘAknAHܧG[H9YG`l>2vk獟#;T M2$ ҢKXC4U/X>)"Kkstwm=bԐ-ѱFٸ7OƳ׿\a2V|H?5%LVD%o,`РO;""r'?MGٛs*9=&`5f3:SQiR٩}̿W y4Պ|s\@ u=T&#ZU1(@7h\ W|f$]CԻEc#jEyow}OWd`D`US; Y0‡V0i.2p<ЬX^Fr n8(5*2z 6;t$!M !S!$Fxvē$Ţ\n1g'O,\=C:E#5c +ã,qh B.=OeWhT14m陥TsDrqX?4oRLI@P<- ָ9[ɭ1$"_?j&$]Kvm"EX9 K8c7]FNlYcHq3.jb ݟ)?U |:ڳ{p !c}ٵ<qhӄpsYQ .SblDr 2.w4.25n_dɶoGgLu6iְݎU ü]!=ׅ^XwH(~P7WoWql[Qȝ;P#ښlmXR5=`Ba.b)/'f,fk[%/V)W-ٶcМFپC@\?Y6af?pl j34KtC.;|s}ˋb1t^ہ/{g 65feJiN9sgmr HMv}\a e{ V xow{r4@lH`); } sԋ(-=AГ'U [0חrA8eH;ZbWc/hD8VnBR??/Ԕb* Ⰺ(<.>5Y(x\,%});{FM27,s&4e~VKB ȓNjF3R?!CΊ(zE1LXݑBG0i?,VKPN^6ԭ؆}kfmoW*3Ms.OZ?F˯K ˷ dVv=nCTSlJ*5Ux68.Eso.Hy91 Zd׆}QnP8F 0}J Eږ4#F)Y>kgjWIZn߼WeU^&ueg{Lܞ(V^iGRTQˏrɄg@vf"Ĕ?׷gÖI-\n>_ce<ቲ=;_"H!ա Q8 7k4ɓu-d˱{ F OҰ>%~Huv/$OS% CtAO"+ySYH\`Ie*=k,ӟ)6Jӏ@7;/ x3p4=N?59P?(aWrSWs.,WoXxE9E@5O`蝶7^Tm6Uˆ@7iR`aD%vI]T֚oz PдbYM(]Ɛ5[k潷"tEslwJ6IqS Ζ:L*cĜ=b7#+乯5e: r;'*6ޭlc$PmJ]P+je`H~!,^, ; \ְMb> k.2@|{.Gn<6_LC\c͌4!ڭPnGZ [:g58%Հ`֋ˍz\o̕ӏ ۹H*?y9Mx/Z;a+Ҡ|q9T mGZ9"e!D*/=5J * S%qLuna%+Abkj ee]Mz4X Rk 6qQD gŧEA@ig?o"irIre#뻡,13?? nGoug(7x0l65ϊN{Xqm:Rc178q H#Al+" N5S5 k^;xۉ!Q&ÀtNPxY2ucAy+|k'X3[~Wג SJzsu?2g^zw }%/ ;ڐL)-^?n΁X% CuA;Jvmw2t8.wP/Hx`XAg(,kwUr _ u}Jxk;Ol/C6emԮw/ɵ'7^LIT ƣ$?Ac`|0 v0Nx ombzR@7i 탒rj3 R3ur]=@DoVE4IȐHP[2ZZ7*3Sny}t}6İwlc SDhź/TRwJ(p' Sx-[48ԃ&7WY*QT!! ||a@,kNQ0(HdA=o H4Ճ5/ >Tief3Ewן5w삚U8ƨZ'm|hTfl )%f q ٮ2(ဨw‹1Q3+OW׽1غ.kk`h5!bG)ѪoNƶiJOEsa:\BBLYf C|%Brz@LZ'ީd exmXvzY]!:F~L+MT97aKw% j)9[UpxwT<k>"3{g8p&׈hvҧu)pb8bٖ |>otG82+Wў)8#EiQx`/̂~X*b7[*\ v ź|@6Xn:6ݺ }RBso'x;%r۠V Ķ י;sk $ѮZA0UEN%-;Քծݫ Ff|aS:{Mp/z\Sګ)$(=YCmX'E;9_!sˠ-: 2C{AsZ d$ HAT%R|('zؼ2>}!(`+{^ޥYšLw |z n?9; <Tm8Ĭ=8"~YUj\? NQrpAW;"CLt—6i?|*I X-|>Fm錮)/Þ!BO.e@m"}2huS&g`)NGRQd7Kg.rNêI@gdJOzbH>1DŽ|1ܰ[X4F#[fPlg m%v;!X?9XApunj4I V[\^Scuz94U"ƶL-R~@]>-pV9t/!fNw}F~' cMݰQe`A{3LhNZpv4V!swl C0SVȞ|Upjԝ͋526Ky͘{WoE1UPl#>peP $9, qwF`פo@mNWϓB n⓬W'=ᴊHMcʻZuIB%䝍R EQIzЕXZ١ dhJI h{CB˧&*n@+"q =tG/5}9g#n\{isˤ\g" ^{6tlvprB`\F>Q#vlӤ!$4F<4gtX`/7yK fZQ)1䮙hoa1D,4f.aW"OѱFR˝  \DBX9mm!aX?iTmfF\iBlcӎLlE].w8g%mZSa"J Kܐ!׸7%ڇ.@Or<<V"fL=vچ[\LsC`lY4ZKՅƐiaKykL\Eyk>a{dw\co:GнR|ܢ\ Q.5,!FS:Y#ȜC%D$ۊ ػJNldwURւ~}dQm*@i1b2F]!?C& ]V'3IkM̧̉tGU:ka՜+/ Bx[2wF@ Kp%LT NM wyz+Ks$y.p!h(rE%-Q\90de0?)۾%R:Jo?MY%̜n;5)k$e/!2qQ֎Wd]FG$/*Ytk :=KqFUM8sX\q$k?`! *1qc{?c)nG4B}] hUq5%Rz&-Kzrkyψ;tW~أ"6{ GE&aF囦̠"P"OT ʫ/yZ6AbNe[05?j]_+F "w8IA9IMThșt kkC>>Kx*Kn7?沚5Oƃb?:V!Zen_A<mAvR*Y4}MtSehi;>(g%>P/:wLx4nrL*V9Sy4XtnJ:T[a->[?Z9CDaXAkӻ\ <" Y İ4.kk&xl"8\CaS'PC'S=1OV8 ;8]ݹA =eH(ЉTAd^? 5e?e2UeByu~MUnIrVdu=eY; JNZbƾm0ɇ6!mfoIa>}e2u}Z8o(GW3_ϗB'^H@i@ٔeva,b.ZPN^[*+.؎O W(y+AqOZHb3v%Xn:X@6jpvm\٣VMp!pȔ2P Y P:E;xLXycb Q:L! Y>;H€|-4W ׌,]ӾUڲud/ .T݊׫d|\ETAffxNDpt7_梯 =ˌmANP(<'[ 8faV,L'=n9RQa*]ԇDMt,~tb.3 3Ф:RY ;UZF Ǚ7gPGL办3t8^1]pfFcU{>~j̈́ _:'$AVhЃT5vxr EDZ|h{Ku$FQbkd!5bWޘHqƏ!2(`IoCc GKhsλ߸iFR5{ճ9>!Ե!m؋nI>*}q!V-^xDCG1RBw+9 ”v}e܌zX,&Zo7|ټ:4kqsaNnaPM>j,s>z í.8B )CTI%S1O'C6?l1ݴܙ?`1x E*Od2,=C D7ly]u$>[/]+kDr!/lbcay@J LVx%ϛq"6٨U)8W%M?.~$ݵC# \HÐ6q*fSL5{B.eRp2׿cV{!28WzN|;^4fEa^i "ge,.3p_}Cm-'* K$s}m;;S7?6zaՙpKl.M&hwdq E=ᚚ1[8?PeJBy Qj3Ż+XuJ({lhg֥;1uDl?n qȆy͇׷o{cN$( m"Ee(GsCk~C¤zŔTplg'n;d Or*ɭ]!Χ5 3OiP@UcNʸW㗾I考~MxƦA#A{+)ZL6Y^=e4 ]UW HNL)_6EQZgBܪf ~!>d[JJ:wT{CW(~o{3=gI=ڇa^~LSGQ9} UKUΓ4]JB/ *l~ @ PٻʿiwcHJTc~auLjvtf;9Ȍ, g[7OK&(kf$}X+aQ'P\0io?w\_xt9=@lWd'ռ|> DaMY|lzVn<#Z/:?8,P HfF<ù[ucgRaOVL I-n<07ɤ`C[J!jGIsp]vC璌9J$uu4&Aey'3̨d>MH M=;o֫B +ȢAVa+t,zʱ:=ê$W30ڊt ΙJg N_;m8E(KQe&+Nbtm9<( ;&g?i^7<n> :4.c*5{T=%LBD•x\8]l P8gzߝUl!!;J08?\Vc7S-@x5=iSvˈj (& Dtد7aK]3C/^cՔԀx(gU8\ү5JRew#W^atw.zֈ+Ш 9?ju^_v[kw6EUI#p ƕu1C{8k4nZ…Џ\ӦLD2b(%' {Xiq"ĚiyLǵߥkH8>.i"o6'b_5).`&ϪwШk_5\g166&x&b9!]AIFA]@1F#x8'9l_-`/BJJa׋jN& :ĺm(_|!`/b3W?"wUcx B[uQHemðh :6B !Nď xqq6ey0iGw7zbݥ9+JߒUIQ0L=Ǖ18Ww/dsz!I~ Ql}[-٦p^Ruh9* ^oE[DtM)c#3BEɗNqSsz%^ :cm3G6N(Ĩ^DDimC2q=% 1z _)5U.݆=Q+>1qF:#K|d ٠8W ȊsnRzT~'I G5+Jg1~PG 1 NJamj.꒳@u5 71QGDc< xd lN܅mFAbjϥ 5@W818V(`?{+HVӚ2fF^%aBCثQU "~~4{N rs%,X=緣ft]x$H%r;n2E6aQE bBz;ʭG璘N-i&KTtAWgdm涥qYR tsFt=6Jޓ}ܐ~֨j}6+܇ Hk"FB!c%݀]6,ЀJէ֮ J98ԔI}8?p}N8!){U;?&\2#'=B~9V^i/A.]m|LH>3|T= Gm|&*f3ʪ_  >_f#10/RS kׁs'bx(2}J߀oFgFݨ;\WB`lG)O"얓irj מ,V]oB=zd˙r$S@6gꑇ2R=N^ A#By쌷>)^!w"MJj1P:ODKabEPCQQsYƿ"Az(Jޕm,l6ꫨvk5N=YotBf-,DzfW7invL@+eVhnCuҕ:x S0C![PHٿ,ӨZi{aʜ]{o7W.w7A@vڠ6 Jw _lg :5)*:UΨ%0S ~TiYCk^^{-"XOa*9UcYb~q(hѫ2<௨;#IETgC#ؓ%icAG{!5ڥ#B F`eKȼ ߥ^ J 9ØV@TbWAo”GoGGo2k S!Ϩ0 6ձwWƑ bi_J j7۞8yKG0SGTH߁:&w)k$ _ x_(:[zM 'm-t=۝7YhJ \KlcE~2ꝠHkԹ.`9[| +^!ǔ=ZP8BV6W$c-I[ۓ6KiOUeEƕx/1_Laɕ;}-t-v;&yXpR&SVyC15ʗ1P+ :3Nfĕ76M5d!ދ ֮Pl0CuL7lWiH_%ĝy*|3pȊP#L_Ad,$dkHG^G7emH'NOk%9] F '8OP0'{/#e}ƸJ/WS@ܸic3p@Xbp5$H,1vJ6jx9ݦy ?|-9Pd 6["ktv;|da2qڃ8DuTy#3%& ZvC;u>uӂd2Eߥ{@V:PqhjKŶ?v[syP S]& ;l$ys{頷shkFG,B32k]p'c*DM'kHhfI0$tԤ,%> &򲈞Q)T󤣢G^fEz?o 2k ,:OYLo*`vJ[fohќzl~ikT 8Q-Bt31pcz@ 9sHMh> VAD}}dz^kb9a_1x1Mz2IS'Kڋ). 8k.$X(|sAh\nO^{Yb_+YdE1_g_%M!ݸfhf|Vwd)1ۄ/O$崁Kx?^@Uˠ|,ϳ`=yw.`oEN(N.4V3]s9՝`*VC*h#G7e9UIdBC +:S92$Ѻ{d &$ r}@mG*J6 y1]Z{y'Va}#*\[ʘ9~TE⌉ Kn>_7r L&juS2wn??c p?5T9| F ̓suZc(qO#heeB0}v7| hEzpz$4W.mIˈ)=k rpԹgYa58}/{9M~z,=P,$T`CS$}oa:/&(QYD1Z ) E"^}5(E_7g-}~Y8?P HSkzdn@G%Ntmio6f=Qåp}HJcbU|UsZY/Ce0W+<[][m˻hp;FF\W |ޥ׹NXQq`ݛqm q$$ʍz*{pF 8?3U5D9yn4\qFhML5楬`ZCSN m\plsp"NML09FSpy6ҠuTq3š5Fc*+S bgyOS"Ug$13;/*v1搚dy"!&PT1uDeDڱ:cZg >:c/_A;gIs:hP@Ned8L/|㽷곓 4G8vkj#=%7 2{\[*J7[^ AXrkaӞ/ /,ƍ,/-FS1:Ĉi\5h k0hJJ?*b\)SE?\lg+ Xvy1A00&6{_ nw7 5 8kd_rb=FS5n^i+MfIqsJ}d; 9yl7UhFՆkN(AӔ>'8 =\)M: =%O|DCb*g?Xj:U-$8 /@7J[tfw;qpj\T(/ldx~Sс}Apu撉AAA2 q U~p5ge'itnda"!1)EzPwO~ 1A g!dnROUY38\wpCAqȅ L *<((XP+G_p >Ψ*y<7l`pn]&=_;p>1?*?t[f,!?`|KVʷ }&.~H=QG#JԆьz.ܾ^ NU 'Nz1hזXD Qj 6ƖgGdY3_9ŇXri.,<+\|[ PJCnZl2]&TVIwNP nЬU{<v⏯|m< `.}PQ(.,dLA{~":_矾v7NmIY)Q\PHݨ.qc:< sXFU8{,DJ꟎~ c.x-*WԂ\'( 39Ӛ|)Y.pY6?{ L7 7g694AVq; \y*2=!^svyBx2olOd0SST[b(?omuʐ bx? c=BGSpUwTj )RPR,'+ SnLRWxxn y[ zB!9XaY-(\YH[UÄ z~TBU>T2EXNa,wӍʡjWA.. Wʅ+ƇR'ʭ*)\Q'S0V_O'nc69N|4%5*4_Th z^ջ4Ʀ(Σ﫛L^_Cndl'Ѧ$Hs48AY:J*2M߿^YGC?ѕsՌcb8YtDϏC4*[)#T9ЬbH\ˏi7FY$k]5Dpp Hnhh%B%$U.@/Pۅ 6_2|6|;U)vz9C- .B2 w +P' #m0`B|us|Z1h` |0Ou\PDW-wni_KWs z@"筥D%M` aE<֖v}1 IROjlAE!E-Ӏb@areN>44/Hh;65'ESc:ނg"]D@w p rp儸] ut|ɻU)?Z8B,К~հ҂4h:8kqNaZ"}X/&4Ă 8!mFO9I-_;ei muk ahMX` jz,\$n\AlܕC&9ܜ>\Jp1iuU,_Th։쨉;[rZ}rT} B<9􏫾nC 񵯭`Hv1EMDRgΗ8dS;< !G)-><{fz xdvv;H/TL}\0Ut+uIؒW{$]K5l&#S-Xu tv_=3ܒ ^vS~Pd*~ӡbN4Jm\ _PR!B/EU]"[c ]uGXxa@*5Wy5tW+y |@H~Ĥ_2G!]YV@o\MdVL14,x",MйFi7(IhhLrx MHZ1,=Dm_WLݺv`rw|Uь` ~lf3U)1sm=)Bx欈}(v1Cvvиkpk*Uئ@?OAgǃp۟e_s̛T}0}aa9ѩ:,z3RqT%7z"h^6:e5R[Z휴6'#j+@('Xƕ37p]ug鍕ez~}V50Vq`N<SQ};Ƀաzk(@Bji#Da]TejanRn-8i\_xK*y) QŪkH@/E؈OkPꨬfb#藾P XA{Z),`JB@AUZ9SAk`FE k (egg} VB!7hEkc?gk[6텅 7!*D,В* 5APp3`Ga ,l&Tpu8%ɭB G#vX =JHQCGUU'sq#v^ڬQSZuI 柳 Xq(Bs u[XM&JNpN_kot (K*Eh/gIEX>r9-{!-9CPٹ$tU/K=}n꡴kY.n8$-H!QucoY@AQ.Mqy(Uδ⤙:XkHz%@Zr)گ,(鷧7!+\k1^{uϐ@ntJ\3Cw &MQct71=;\'́QOH 22@v,iJDt?b:-2hסV9BKY_voVy'L3&w8U;/:d3ٱl@P&U%=,;  An&"߰FǴsծHqKM[xlpqY p(790bҔᾏV6p/oH]cAG9! 庤Te[ pcY[N̷-ҙ{MDנ/?|xoX='dMl%BMCV|jLZ{vcɯKS%.ღuebO>uB7T2 t\؆W@47\IIHK𙇮31%Զ>5qRbS [4/\/tiZYsWԚʱR?kjRvhhD塅6V [@z_Mƣ^LJ4uꈘq+ȋB"2 }=]\zwoDw(wBccePAp'Z)_ E< $ʏ޳b"]p rqghXLYƫ..UOp㟶՘2]^#]VSSd".rRn`6ȹe"|P2n4JAȐ(RI?(B?v&GS`>޶OBÈǺieB<|I@+ҘӂH7p8Zj Onɼֻ=6 +T[p6_kr;IEU)(-FX\.5ͧ 2{86Z X.b2STe*ש݈%+R5}ԧ}kPe6җȱK2RhIZ}7-\Ws:Yx"2ˑM;8IX^7|RGRpCS~ rןw)Q\oØۏ,w W( 9-Qx{XJͣfYt&~OnK/ WOT1Ȯ1 Ԍ]v #G52Í)ʽޙDqضelLPOX |sm.0O&Sf֗LLyT[4.KO*`;1&C\AAq4Y b?%lx*?b+(,%ƛa Уo ]&D? Y -A$aAja dIqĶ!DG_$ 7|$/>ݨv).6@$K-& 3 mv"00e /ONY4T]* jT2;-A* Mp7)UEreƧݍlрR̯5rrJy5yL톤zħ|ԵW;@Ep ˍrި' xJTǦtu )$@!/IhL9 p{K"Mz,Ylہ2;Z[wô<5ůu\no,|'vw2zm~MX2RMO 4 S,%l]90Ю!-iJ%g,xv̝Vy.8ʃT~ $tN:8i\%lV-&bK9P, TfpF1U(rѧOP@C;hCŲYIvоx_Iq ?\g6E3!QAIj&^B 6UC3L5jҧW!5\z([*lH;Y\:ނĈ~7Ec*:Rsq 8'-P%nxmK-.(iF Қ."[ rcl"g#xbtБ4!DMAB$s`uERY& :5%);gBfRGNiCvMl.` L%s'ݒ\S i =h]s!bԔ (x~9uy xZ-I,P,I/) ^*/kcɨtv!}un' ɉ9XVn< KxUI^rMup`h2O4߰rUJr}$&.c+7+i7Jb}NcsJ63;UI5֭m! ?5 "mk։>|w0E]%4Ҷv c\NZ0:5.IT;cZ:Ll&추kzybHشN~o|r OtiljXE&|ceI=%Jk+;;;^!*aJHNUs-_!D㏍ݠu &q3axDFc]]h-Ӛ; ,у%v?gg(X^A7w] 2=woFX:kI[Zxz8vݞ1(u(A[%SC=,ωk?0pX3 e{[x=e9z "PuIQV;ɋeM^Q xP44e|)v Yi˛#CR_oN_T@.Ifzek0^WGOP1`Ppp#(qlZN$Lb 2+V rMo&G/k?#ާr8bDMaaq?&\waբd\IJP0ק{8.AÁlPNL?~y{_o0y%%deJidBHX5&RO ou}P} iJXxD7fSPú'їsjiȮ> JSH]#EdniBn)E^oYdGWx&0D 7,>ۡ'sNhq`Aal-'~&{׻-db.͍e9G(:]eY9׌O>4/ɔ! e*)`d=V 0wQb6W?ȗ"=M%jg-W;k2jfm &3;LEߜm"!+}SX{]Ve!fyHzBu,i֥JzbɐBƫ}Rm&gH:4eeGٌЏ P\=4:Ac!X#eI~B}ᢨFGE'Nr=ik_󇽣jX I_,gt1PJ)ڹwݜ$fzaʘװ`#v;"^-f䑶Ta3#=JNH aηAaKjᮜbZ46StO)LPM4~I0u%O3X54'$@L+I}gqK\Wkw}tW-6MH'>l:c*pq$rlLV&:a?J }9MvJ\d-.' ]585j^␼1O6R77}p;`4!aD6lhtj{7,z!O0 @!uEbTGω)JIrx.ƏsƇNI鉹"Oygǐkjߨ,]:a._wWYMw#,` 5E X%˪bX|8<*pE[GR.m٘S mm%6:4r\7W`;Oa  AFr2Xdm܌#pCwPdlNJ> v! B*q2H7fGR -!ڹK~쀮sgx7)aL2MNӗϸ"nGfoz}we6NXB/ r֛nI*U%'Ṽ Ǧa=_䗞"A Ѐ0U$d{s8GJLA3,CvͿd:C1p-%jBd R3s!7J*1A >wމw0^ҨsiC|:cR: ;=j t hr"q=op0ftӖ}9,!$ޚAzoeC~Jku&Sen1^1&[;JgU" M<]3:#&%tZl $4d0 HCYќ /;J76u&YKѐ_p=Kf)GT](=ɊsپQ(t MG\#H4 .3)S^o#f_k:ZB`P{(|bR/Ó8YAolѩt891";a̍?1>suH)w9! Bu-.Sy^sKUTL~>R>GIi I Yg#|ZR"Lj<] LƕȪOLMԡ"6DNU C1H㱢;.UB6t%z'j _ J|AL*AH/%M]12Bn!d2zQx"Cf*`Cg`?(#lx~9Ue 4>{?R#So4!Ǟ@7ӣ2K؋ǞtW[^oM~YS:|:(kYqB2n ɳY}&C(H~h\F~8*mO|F )!"*Ŗ d!jkCM{0`T&I.k >i P3%2:R.yt@Cs9E!n2Tg<P wؙ(;p{.C1sK~I<|xLnYzYSEG5cw9-x7`@חz19ōtjWIޖ⯑ϐ Kʸ=<ԡΎv@u~m $#onju?He?DaxQcSqa6G92p$Zߑ8] ӫ8%T 1 jw1?BhzSM? )B HW/m=սoV޾+z/hpq7-BxYuR_ȇWwD*] z[ 2q&P#҃-e)0dpT2Ԍ7S_Ez1|#}@;Ri(BRGNa.TȦQIS`O|Hkr; #RQtGr5iPWeDStiڄ驃| V3Fj|kŤEO/0pbEK-sc riubLA c{l:jbw.F|1 %ESB dz) d^< %Udϖ0znw u3Ia7  v/4Zzv DBsPqqq_ރ|E7 toj[,j>5a훟Æd"YffHܦQZ-*O<{lS_ {z֋]h-[Rl8^9reP/ܢQjo+F36{tCZcFz'n'W0R?_beVKQ8*F!͸_>&$5ٿ@ Sˀ2E5&wgc{ \}YAo|Sgv7$vl5h(צgE_al5o}"]j8M2Ar=E%k,)cIb.wUX`4D !ku H (<̭B/%S Ftj!T_ A߭˺i&HڃXD~X(X.nnoɢcvw bSV7RCr[u ~tS l!zw3?ԬƜ4w-ϊŴ3E]݄!Gݎ:6wy,㵙}'@2|QrhTejv<9kx; -*cGA):Zh~ [9ӵ3+ p;CRn`s 7M5;Ȣ<+ ;:R52okԩ<9ֿ?f/d[L9Uz .+PAN$9rnJ276+qX:SGO|ί.e(۱3 a/CАsA27%mOWd;\v?$y w!1ٷ3q 4wB Zk71c  .:URa<2"|(I_ ).}}8G(bKC *3EͬՃ?0m&Ε N#$>S:z! [?I{HQZ[T&UiދM]EMBSjVJmJqk^UOB=8/bvAaL y,7(1r )&`6>p6+2*瘙ңf֓m05Q>ukZ'{A!YI 2{ؕ;Taz @ZS Vn-C֏s5/Mp";L%>\NlzmmTc_z?g"_?ijdpr[^k)7̴S#gW۬. ?رKO`*]( 'f>_X `2U 9+c5>"^IԵ jO`V+8R˼0r +"7-f%yt0F>-\!J{M,HM nai4mbbj`F)YmPp8=>=ꅥCopTry,?>F_z81YuwᤈI{bU^/gs^5|9Ak"v6gX{|lPsH` ^.qgZn˅䔘 I$[b*Ku2@ҿMpuz;)-\J6~( |× ȪZ G|?yIA{pcQ m lc2c_WQvߤjCgy,1{O^T "+wqϵc0c3]B"+^Ӹe,.l<&cؚ˱A; 2E~ VH)A ,x_@ G*hMTo;i!f{ĺN4WK].N$P S| ss'n?6#bf5pez u[d!gY%Y[y;:1rt6|ʸ6QZ%`$opA]S*ᨬڌC*(:-$ZKa~|znEZYNF1IA-+эE8T%"Uzvcsj;"t?a`7j0.W:UXw1' hEz/#rwЩS9oB qN(84k􈾕=U3$z8c6OT$px0و{E}wwK.vKaY%`lema3(q 3BJ|7Ή,꣊ߦ*W5.,L;λuw3㠆&x^\p`^i]7^z Ka~|{=8/>,GxtNZ+ 95PJyjs>Mpxf?U&-eZQw~hԂWw,)O`ܡ ?6&]Üƣ⤝7!JuH: ;87zzsJ f:X{dKi3XCΖwMt*]NBK9ZfTM.$JAP@Xˡ@C9_6I`lU,/5AC8;=ăpћw~89:rTn.YCoSzՈh'8㭟Һ& y;hBS_1lj{YtTpwNJfI휟 4kLP29Z*;& jr#U0\A,n۰r 6 փ}HלUwfzzi;; wKȭ ch (媱k{iH@-3u|!%fD4ϵUMǰ'}_\$FMBD;+5R8@]L mLgP4Rh|>-~.}փ.v>}qx~>5e.%]N5f&t-lb0s_YQ%62{h4ǟ;+m$LۻX4nbOC: f<\2WBsP=JI%%L qi+88 kԫj@e)לcB%f벮CphpKU8w.uU[!ra+4 `4*kxZ%/B|H1^]˯P^|4hXDRaE%̋A̜% o[WEV}iKNRO B=0BTm]Foq3׮νP/t tfH.!j  }u2HxgԬW?タqzꔤy.3h^&?Xq^Y}aF|_f ~ElIXȧC,Z`1S чUV&JdR%x7dWxy&3WMj nƦfl"ҡ+dA)M3-9K=hm4.t`jU2Q~cp=QZG@c!wIPb1 aHB@nosP4ii0#u]4|'Gy<^TioFIO[Α?5aiy* ph\dAݕFڧ;{2q; u?m'P{p _Iމyu{{[v!ŠR@NH$q?Lf\b.~նIkk^I8/W(Z7Q: 0!0,W;GKjT@ݶKbr>9kۇap#ajDͭj?-g xrk66uQ؊vg$)figyU?lᨣ^lmw|#ZXM%+K;{OĹ1 i~2RӽW6Q6L.eH+Za.}e$Y=pݶ"+qm`( ?s)F+5OR<,}[(,)E%9V:9vE t.+Brw1J<y4烾m>oޖ'ǘ{$#[*/q% /u§Lʊ+jGfr:gq z ڎS\XZхC@"FW{vϑǯ;0ytaH~; M堎-#p~2OCv6mg__51tʜ j7'Fפ '/K<2qm*1V0Qxz!u.17,Lu%O?H>c@F %/K^$czn!@of:kwlu&!w3' >ى;*٬S 4W|aSf[& ]tD,!Bs>\ZlG GE ʦ k#ĘPY"[{\sYwcD2;"*K93T%ka;'8p6FG 7hɋ ^ 4pU8|'rFOhp`D*{OEmk#4UaAޯgYd,C砰cy֢wIS(KG3j"G^h;Ct#y}^U1BpRiqu+,4"gՋOQ tȵ2_},}4ΓSGfI${ԡX b)!7R\H1._U76pwPX+QJEt!)hAݿlS$*DJ\9r%*/V|S ̀L42U N^HMpŚ+@MkU0y'k{FR[O`LC@Xp4fx=fu,j IyF?xcxE yk#)Tt]fu^Z/Ajp}.UE(TP as6Gg6hJg3 ioȸ=.w<*9]C ZS5ʛDže1fs[L?Z &_a jX|A|FX8!V*Ѷ@BѰRǢmjR~Bp5;C^8 No=y>TOͭ|G)CYuO[Ho$4'Ɵ&gprً$Z\#Fx<5>INPܭq|Z1<\m=`3UWysTl-(W=2{+o I)89BBQQ]PA(=~{Y0ll )tB-4Xř?͛10%[OV[L…a0@.bh!YZ'7֒3$Bo 5(y*@h]D%fKJk55JNsc iԘTRE3?{c;FƱ Guj L>UdM4fս͖0m7iq!mn!Mo-bwweUZx"旛Jj^IԋݥlkL/HgPeڋ`YbfƟnub՚ >}u( e) W:ykx%,NDl>Pd*Hz^;xOYWI1C #}R7-UuXpl@i%`rAHub~R&E'4T\KN +a~W6|} 09KďL) #ڢf `/RŒuς1Ix^Hh47[mۏcR[Մi֔^wM[CAm~]j|$j@q6 Ď( fv8ݖO?1mAe1mtuB-^8nM9|;/#XAbX>Yh4 Lj?$}Mvяe~nfŠLXՕ ɒBXyW%BJ]͠Kg'CR>Uf %W&&|+խDTjOPYFkޗ峾Ё ,x= F 8f)8S`2|˔'1J:Ú"DfT<|lS(*e53#)WX(̗f 7.;Et=Q!d:BM FI碒w'JD}ze7L-H=\M4?u+t&?TLaDS:V\$B< nwZ⬵R`6^BEI"^QCۣor[(Y]桐 gpљPO/ ]+{lq^I mm.Vs=֊Nyi @u\kѥ6i@cW‹ҿv_z)ռPIL@A0L62GQG1< 1z)=;Q_N/5yAyp.{M}#v6={cӒ]e>/% Jhsqßڏu"8\O$ ^j?lZe agK%Kn}o=Xhl݌VL|LGLX1D͙RueL;yǡ6=}*Ő)ې u9,VcJ|S$/!)c|)2[mRd@KTg@e_W 8U@yܜ(Wozd$M 9ħ8dHE\Lh+8^O+{ ?H$&E'@\.Z(JIs_.'IuaM3H켞PwY'Bz$h cOA"=~q>Y D;ϔw ܐWsAUAv6X/ܧuWG+|by=d[ܨ~X^I,ʻW,dۛi^ox uzF +Ek]ާ:c*!AmF wyP Ij|Ig<޿^?PXh&-+, :vߤ#QBAfBQrE CD-ʹAƤܺ!hOn%e F`veU+ρ,.Z.-3zz{30ǸRʤMcmeo5Q]ùB.Lxzo%꯹z)/Bי.ǖOc:}GU.&b$`)U%Cہ F:l{<(PW(IL +ڽ iSc)ؖsLf<4OS8x(p3FƄd߶Hy4C[˸<J4j-0c-r(AtAP@\]5NdԉŽU͙|Ͱsqal]nW}r/?5kct;KB,>h )xѦUK.}[{X5l 2 vO.r rJl۟gT0+C6[h`@#Z(Zv1"D:wV Vbd[=Sh\uAc?{}]@ԏBFGHXƲ+L[sU9DL2Z9M*' IJ'oE냛eowkBWzc8չ(eӷ8ͬH0˰r{닣 g ̐zÊcE-A;7i\aP2jխ}-*HR,u\2NG^`*w`a#p} kʥ9k?}|_=&?K]&RmaJÌRv`XoݯO_$rȧ&od ֥ת N!X'k? ݒ|`sW!! 0y9d`!ĴkoXۦAutAvΫpSre`*쑛PUꞧ2k$惟Csگ$(՘˨(@u޾8Գ/S&BUdzo/ep#BCQ%;Upڜtw1hۛ3OA6/7IdlZ'*s Hw1ASM8!H,Gvxldӯޠ N] jޤiGl_;1gFUFmpbHD[@I"xQ=/vݭ_hȋ/+DP0*^U,l'TClChP]jח|1"yA?o!sD9E_4)1rOyǸ =E<$j@VBzxl> d~ΎrAk5J a}jve t ]C̰+~E$ lWaBH5!K$S3l':wH1s<~ 䥣IQKMp>zy9N(VT!C15WCxAyw0g$l^'Sx,?N+pɕ>"HEiFp=ʽd4 ܓ(13a%O(^c`x>%CJPQ\!p>"x. 鄔10`0z8ʌ窋TNjܰQg\#'XCrxx]؂0 D2Xw#`rdb!żJLiL G~,pēuB4ujny}槡 qʩ+ɡtXUE{Jpۤx2xuBWs-!K*C`Y**fn`OA93YJpAߟĦP5@(2q1DS׽B d,O94L ]X՛j,K5uG5#.Ѯ+{Z}S%&`2&΢K)qS- l4Xp,~p|q?Tpcj}}{xY&dpCf  sbxט%/)}s_]`q<iV*c3]Ke&K\Ix%} @R*OBvMtO5Ib>Q],Sv?4vrlHUc7k/$x;5n 3"dA )r$  Nu(g#a5>Mϡ\Ӵ]uXr[uAl. 2rXVKˈSS Y/%FhdRkl+nQ _wv"e˫' `F¨8(G7w, zҕS|;L8 v;KbR) ںZÙ|TlQ 3Vh#(EUA[.Irj;Qtf}Nnj T. 2XqujHwb-o+; O'l!P#<ۥ5׻ #XFs$"Ol.r$ >@6` S-9՞r=EjNu:>t:j+W320٢bʸszΡE2%n |^ 4!gY4 J,_t,cIľHL]݌$S!v:BD!&b~`c"RT[dc IY)Z`x=WJ&ny x$5A1`g>.(SY]j\dIs9a?^NIŅk"Q?:ʩ-E\)F\Jݖ!­ T@(>jlV߳B[@_9@!K$VTIzY䨲HݎIbH @E۔07`3eg0l=$ێʮy50='g>E>nɔHÀ`EdbCX Q5ib%qDn@Fnc he%%qPѪ/S7ЈV@ɌđHx2gw9&Z~s(ljt#6;{p0809NO1Y7ޮUt:zh\!y$=_Q2MUAQxϏc?!_`/&ҹOۊk]r-~TR'U eD.ez+W֞B!T$ы'1b|i=s?ȋB@ ֒%E- >^o M1eT]D3րgߨ >&[ƜaQ6VC&Lf?RSϺ`5wߌ9S r\hO!IqF7`Ag&[+]k`h]+Q] f7gn O.Q܄~s%ܾM~éOVq`V=ӻ|Q>HY7L|$K T46_| E)3l{M!5PBs 5DnLnn]VQⲘe/URϡOH^dLqw.avbA؃^]G+uq;>aŔs+3/zfeSaxl;x"ԁ nΤq"jZ(ժ/NeJF7%HQbk-oxr{RQ[dVa?Ho= EU\[ cxHtjLknf|}chC._|N>;GPVRK-=)pUlxe_E5=n&# n:8255!xL2 `hFoc\VR Mݕ̾W{C[!>] ؑ!'Tt|QNRnj|D=hݿٴ%H>ȇni$y^oIxzSvW#;;{XUT IY. ] }2Ԓxx/;Ya ^ּ #&Bjm=#C B9R<-Z+)$?C*]-AkGr[1W( "'bjK aE)ǧ\ˆ#WL <ԩP* o#>`3ZMhxQ2!>G_O|򏾛025YLsN>|.FX#C5 Båb/Fmv&ANdBf)MbMz e18K&y^*]K`gB8KA"ZNr4.LQ-ܿ!3q0:{Kzl!.|@k" E9]'g>ԃW°/nG_Hʏi[(jWKS3ȱԧ#ժ@b[ ڍjnEĚt1Rۦ[\ii:r,u5,֗|.03].S5:-Ǽt e nSo%tXof=ǂ `,'E Ev=WʧNTD!ot~D\`B'by]̟P-0!jiK9m1?~;@I m^a(őߐWMk;8?lB%Z܊st=q^EpEf0(eh펤q.um9k/X f|=-.xOw53_fyhѧPcH*+CưYl4/9x78;5MaL60H)bcm.'۴0&4w=܏'T;ŲeXrxPHL|7IBs-G] b렲QPmDrF'U0r89Gv}u [l-\<<]PFt=kN5t YO)NC[4TaV20Jtb'Aمl:ۍgqp:`hn=S ;M!]YV#e0Aw5/&@ VK^OJ~W<)@iܤEtJ~5}dGy}3#z _ /C.B\ᘯ;?򾿆KV|X՚?J!nOREn!>2.{)ԗI{e n-A/Z@(NaPq@h"au>QE&]Mw/RŠo; P}[AnV[8% CE l)/wF Gv_^*hŊP>CŒ9쌠YFM 3t)Lӕ *ק= *n4WƛɚN~Pz7WВ& ڨ$K'z))8)%߃Y20Mx\ :)m9<V,8Yp]K*'v#?RmMej'P5]r?O'44ߊE=|;l`6y@böψwݳt0d|E[>Gch`h=M0E_c_*;(ߤ{^<#RA”c.]J+|KsN0PҺØ89AAT@H[GX4`Yk+ sP9vv8o~]{쯵ESỉ\Ekf`3kي4ٸX]y dz dzĘV0d@Z=mrSt9{̮PTV 9ɌS зڞ߱#ok1!a@'<`f/tr7(z3[@I$Bkq>$0`c3L7DaxzӔ  6꾫&!Lƿ11sJ pW'4FnNU&$$ ZZ.ĵs@ p|{U8?k ӝrE&0(zD醟npFC6z0(|F AX4w eìxpY})/Q 7}@EODƣcvچktQvAa|3/dHu'ל#@}:¹w|dj/&) ʈg=5۸&69o̡Kt\BoLHHWZ$1A<{(?AOKGeFkq*q',D9=y3H:HѾLOPK~&rt P ])ԣ)7eT/]%.Ïbn1SaBَ 450z#vBp[X>Պ?(HÀP=P-"W=۬=K $+5u/&/a-5 )8'ݖVt-.L,U$'>~fjUuE+ ^8ajxfT}TP`dp]M Os`qW:M.<-F 2͔ l~ k[  <|sEZlUCoB(6 =p7!h9*oGn 7׌6AF)R8Uiqmo}ju Y"ٮ(k}F ,X)g ,l=')tf9l{CIy,N LZ0iǔJA<ҾH5sztgSI5T5 'Ǜ T= XA!X NA(NVNJ`BT( Lt~bد,&o=#Bw/,$g̦@.p=uZsoykӆ$A-N.O\je18i  v,#K_ع=/i!޾/}C^5?h>ɄjV+w.JeΪ=6dav)4j?3Wy! PnIdМ~klS*6#`X4xqj1`9^,x*G0VO ,m3PX^[zy!lBxԣo$w*(&{PƷL`ͥ'; )[3z)~-\GKW.h_T4˻2oQz9fLZ?nа)d6fٶ# ̞W|/_d!+*jw LOp5L$C3vTo}'Ry:93 EE'MusLwSgOͼErF+5FCW׀L9"ZS ¬GL]ny-шw$ ڰwK4HH{n dwvAP^G@Haw@?tC y`w?9ǀ 2d2Fw} \׿i*!TH*H,=/*uJWuncIdQD!"EO`c{v HEcMrDk޳H`qA9ӿ;!ְ>))cys0*M:(bPJ2ۤ$|p30@5OBQ(0j\`VP2,_`5vh6x( nImjbq1LΦ37^.TrP al]zcЭntx2x[B)&#|V*0tswn[`XQ QPXDW3i 4ivY8eVZp.h/`a27 pN[q<[jk:~N筍q 4oShH߰5FPy&5݈qJGB), , dp>ZIʌ / 5->cQD{ߛ?3g5)Ѣe4Iąj)1Eh|,&]>TB{V8zH_Ti ,۴Ll\21r?~\pFۥỷO3:9Sb~^A""'_ОY5Ĕ4 >Uc͡{_Y jR NzbRzxL*"9{GB-C4dIu9Px]!>;%$Jdu.R5b. q# gлcU&YVI=ZN(cm7ʚICS ;:`5ײB^k +4^9R"EWr˘ tVp*7b'K'BSfFfO^dc`V~ZmR1O*dX`ԏ"58M& @]ڑ QZg:y?r5Υq^ =bU -Fvԓˁ5ԔO).r,V-a|I(񌟟@,L&Z =M+ )g?oayo(Ge]D۴٩TBVu8TE[.@7,ܹ3ל.`%1vA}wgp-; 0UZ{ʲr@Þ-&5RV"h,זݾc*z:"%Az&@*JHLAgak7WnJK4r ԉ7XXiyz^ڷ6Na\hzSҳؐ؟ r+WJO{juH5)Fy3I6H%Z2nwn{e>~ײ oj{þA5_a2]=U W2FV"W2]Ss#&tV]]^T cp (cD$c]\:teɗ| ^oRTp9\< #867'É0{>C7D .UI8{>e|J))Ũ(HaW%)5%aMN#{  NhE6K(jW5Ҿʒu ;܂f-۰癍Dalz3R4Fbw`A© Ac\FTCjqZs 00j[^^F.A#㇬ӵ{#- aP$ OMj^QPg,hA(+:yq1,dXSB 4+^2|aʽ6  ~+HŒhǰ Ŝ0?TZGi ~1BdM,b !rkV#Q<{k &\v \&~5K3r+M#iJZx:$vj+z"}I?y R4I "vϕ7Tw>daL\3ȈN#r1!e>*HL(.^4A An%c$HH(+k$M-!2(;o,罯6AMtug/ʭ/Pȹ viKW*rybg8뇎(0,Vݪm A`ppPx)!;FAq[~WGE+?^$(=MO$IfJx A*AՏFhh*}>$(,k*'$VmHn_p]zԊpqoRt"b R4` ވ#=kQ*ƴ07\V'*:?+#)*VmY+T8 `۷1nX(h|3wKFS4*?%롘^G;\ؕ2lM'nJkzZҫIstPFc+TIFAMew/_QS0s7:ycM%z̃#k^1Qpeoa| pzi[]|%4MyM-PОd:̆[P*(%iHp Yl;2AO)7%蠍hM\|?dȠ-G p'8\[LMbP(r}Yy"b hQʴs+e–|ҊؗW*ݯcvՌQ>Z--O@v.X^vԩ$!0XCî0!gy@zfJY%ZI f}ZV7:%%vXvu.&ly. ]9wg5>vtjE젏R,GV yao/3l qTU+SngV4Y`eUڇ&tXS,-dIw Ȼэ-70N͉J3r]kgo {!=1Õ9fTo%P6cRmJ* XH& d\BBV8iM@o9 %B"CKMՃZdz$Lb )&%SRYưjhۏL JVl0G(ZUqOP~;m|!LNĻ`}.D׉a@| d75 (k0$ mTRLHq%g8b4N~:nWR8ȩpۍP"Jbc>~1Q[lvjƗDgq rR=!ѓᑡޙ ͘2Ceb|DȌfh\:A*s-ř7pjm t4[U57{lcAR=D~C0:a~TлwK1 N`uyErc ɬ8AtYiZgjؿZl=Aof='y]VFBS✞iboY6頛6ṣ^j& =]pJ=kC8OEC-][Lj?E"ބ:uѡl{O/WD*B+J|rG?kW iF+Ή e-eZfbJi|70JH˱vIFcFB{EX">#(YK0DN[Xc0"NԆol/.4I]WY \vӖPq<v>ۧ3ԏ J> ެZěR$)$3D ?yu- o"0pHwCgs ۱Dd/@E9ڷ)O+ſ<gI@ ,R>=8F_=¸箏Qo&A r5Gh(B^PMxmatcA﷕G[Us@BK2 Bw ܾH`pi Ä mJ p/g麴8b<,IҮdpl (0iu]zS^+gѨU8h!Ϳ ӫ_zWm6(YxxE=gih\[鍿c7.!%QE].يP#szpk<^Uy.u3TuBy%V^Vip]yhLAϦ-&MMYYn,V-B1@}Uo->fnT5mUf{O_9XO5<8~ LnazẀy?=bE:V{-4ώܓ3#}6$ .s+уNOy86̥6'9ۭNj?p YiC\vˍDw$&1I$)B 64 Xc^}}~Յsa*2sF;+9xvwmΛ>WY:pleEg87UZ=:e01!TgA}56*^}DT _tn-w"-+IL0WްD'B>![%a<ԿBơ̿F; WPyɥk*?R< O/XQm/A`y㒐l*7FPYq2z!>,2͡lg)YlFk? ,ؼ?c? Z"plL g$!'}y< ua[M> AE@t%Q f%[R"mޑZ Sk QvA2ј*Ji7uԕ5p!G֧78"xhoa_G.N{"eqA!sk~$h),9*00@y6H5yc.amFɸt}',RfXjUmW\5^ܨ~{N ed!GڔR840b9"KemNA4zҮgi8adOM[{xkꌈ0>zQ~3)dS;܀n<Vn1Q =:()3UT| Rw!\H Aw?]j%Aw/fuN?b)A aǭ$倇Srcm՗ŸsyHXÚN-,GU[?&ks1@Tx_h'/=:N2<R@0FXsyxuFPG<LQF_*2\uWq@yYr`Y㻩U# e4ί =~갟H; :x^$w ~ j?9UjrLVJF{Twcʹ~pjW^ ܇+Lt쫠\y8ʻ˸^cFtȃ/ |K5b= ?;Y{Eٹ$3j^]?^aLTzgUY?Bs"k!q6umXH/q1VY)z[-P8&a_ /% sn:cA'6_bĕb#)Wc}L8N#Q.i*Ǽckcr6o^]DO>4$2cpʭ9REv@6/ ȸvOpQM+:  iQ֎& 0ԇ^%))ȭQ$ZcKsk[4);H9?hNuċ\a'iw2!.gnoK݆, qoe|蹩UoC J]@o^VlAv k|U3!\9U~G.$6OvmؿdVEWRE& z_L,f2]nNn]òc[Έr~a/fkuП`"?q| [!˶M$u5!J?t #I DO}Mtd}5Ut^pD;LQ ,hmyK'Oܕ6YiY\.F&Y橧RS'RB;,lOhCvjzY1X7)̟Acݝs 9`δkte5â G{91z"8"$";(ǟ3ojGl]'cSɺU ".ܞV\ϔC"Ųzږ"l>R|xiMmja0u׫,(5FǷ% 6Gݡ)JS׻t=t/N5h(M0m ĭ l K`ryeo#dlH)=O`~X"vq.x l͸Zok'~4:.^.Z#BWL߰~,%IBe{CgGjE"E,\UkX'wisyۂI/NO]5ػ`TV %_ˋﯼ[c2\mZ<-b]q'֩c<<.y=gZW6&d^Q<BM-ZYlr$Nu8KS!a`5>6`EE/LH4^: u0Լ8X{hbpo&el[.f,1A/@Sbd>: [# `'Pu{f5mphy@Kg\g{m@I2W@eQ1ylx({a{K bxIBmp2J^~wwSq;] GYݿtm䲝W`l>hgA= 1`d04ۊO_%<%˚]Wu aA䱛=M,3Ӑ8y:r'5 8OЉζ ,FFV4UQ% S,˭t*AJގ[ h+_8Ӌ䊎}Oy/ڶudV;-Xjc䊹 8 qYl޳O5sO+Q=RYmzCX|uف~ 4NIM3N|EchY1BqO/dwsR?KX]f!9ŭbՠ`Ҹ_I IO7k󙌮 ܶmrϤ^jXL3`i(5UUEH8!"szQ.!k>#"]7^mYrڜ ) $#{ a_|^&ZhQ+,!-Zñ:5o?m BՉM4k/`#F`nTdT4S$kys7+a0ZՂ%; /4o+œvԀ=Z[`&( ʦUfl;0U >4Nbpd7@JvwJnaJ>-]e"3 lc5ӫY<#.Iɲ!S9[HPg)=ZI+ CB9o06v. aB"uű&<:e;6U>ٮq ӥ΄f- O xoCR p6" #ӭD|-B-MpASl1;t۩@ǩJiU?W}bibaezVUKn\u]͆k]JWqj2u;MR1cPDc )4jЩ>0'-Bqŏn? rpE*u%/viuq (b>PQǴB iqB#ʯK{z ϐEgR50R%-62'bGKF4Ak/EW1*OiZNSÆ/-Y*Ntt&R;f !Yyԡp!ГR_{9E51AFUa5 b4@ҰS FVom3RxTCw^Mȏ}|bq^ { K=KEET~~3wZ O=Hmd%M$-~3OXbV22"2UCX2MܡS B.JIp䗓1#WȀiOɀR^W7􂨯(̅s[quґs>8͜eWv*B~xԡadƘ߅WFC7u9E-^&3*!uZ2$(/= _>:,lE`:GaQF.Gp ?gE ɤθNHhK*0t$SsVzVʗw7/U@Ž6H&Z򩻌Gcl[sPaWTqm`,N5J*c.:*GJ3ƕ]{}DorUgHd?2qlX|"MK%/?5hB*ڍ7zB!y oՈ bCvz~ˁݬ#q` e%$;L 6СB L6_声- WnA.O؄mgFĂ-km2 2(i $}A o \bZ}.9 [ٛk;"o˽CR_lH}N%$ݬq~wZ.yr]ЦUT&73/Ǭ'9,/;kR`0mSr> Nv,gE\>E9dt!]^4d[Ks͠L`M\LknbqaZ",Jd+'"LL\1| x~X=q~iy >q* 2!&$ bCVҝsc+k. xqR62EPgxJ,/& :|!ۘWօ 朑]̍K^@/ߪ FfZB>SHh0%=rｬJFA\+dDjfy#A2 lڙ-"_8C(r9Oc7Lvn\ʝ2T$r$-#$gQ' QLJoͯIX{([ `DIcG\!zjTHaq;]ÃRڜ#6ei L,(?(]9~1&KLs ƻЎeC+cH8,SUhn in!8o&2@0S ܰW'Z6!܀0S"}:.U~#t/= |I} t]NxA8HY0FނS>!]JF"$0@=ä6DȯP {?b2(wr*m"ne>A:i!#~v(x$tg,8D mQ(=^jF/( X=E{͚=c2P B*,ƚ`)GU}(24O[kycj':g},_nJٞ2&sn{|7X.A$[cD}|!IpW ,K``; >=Y jd}tD+.=34:[^nU}F"q Ӗ*%;GbUyw\Ի:cJ6ʧ+qNqd_(\|9z\OTO8lSz=`J"4 "Nb(pXtD{ɗ.EУ;}ccst *6ϋ:b-4N WOtl;A|5 ;^2y! **5 {)Hiۜ6T{𰣐,gg }\Yu=5E|II 꼳#˽i@Q5gLj`@fQʝh2"tJуP %U8: ]þQA犤$E`\i1èӯ%~ (+ƅ 9Ib򪝇SXbtZVзZO*_NhGt ^x B]wrUT<Ƒdw8LSK U`螽 WSgx0DZڙQM )2g{ ZAE`e9f)Osayœm4iCCW@{Pզ)NґCuw9'd&倽Z%Z`Hi.kirvnoݲލ.pah`tftŠmYއ9_y L6Htwm&x<:uK ^~]#'Y8LAUBo9@NeӳĦ_Z>j-䛬(rZz%X3$ƋnqL;Sa+蠠&EkYe;#LKhQFF8>D1hÊӛZOaq[MɅ=Yˍ= ge_sۄhSiP&@`)jEJJm Z!:idž=f/z;ⷉ$kRHUzNd*4 =TN6]&s'$BeAԾ0KkX=]G J\qB|x;^"Wa-Ml#KTY`3.ь_v`r`Na;+J+}0h*FeY0 8ЪK0RUA%'ldx#/cl$>sp@D` PJ鈪,7s^ieMja 6jED'-$O4jƯ*IJŌ0EX)˄R|R.g'Pb$<)RWϺiocUWW!2k0IĠA8lLUX kAXEH:.Tqھ*(1/=#3:d/r<3IۣML*pIj/ p#Y!W"1*0]GFl[TD˷;:MHVOV9ImphS? d#҆n385+#'ZX<0pW`:uJ*]RˊǢ%<~DZ>-CDu^;24v&@ȃNr+(U[S$-VKCKj#TatF/}Zd,/2JL9ie U$kfҵt5 0M֋֤_YqjОKrNΨ> ӱ~bk*!Z2.uƙry];ɼR`WS8zG hv:w4ڋ iknɪȶہΓ.RHU%! WGZ[qB!/"#S)tOR>k"R9}%,7GzݩE5f ^<̙G`5Q{pĦ|II:&l᳣-~e.KzjYyaҽzRƒI0`耄e&5%`;ǓgA{0 xuP ѧ˽(j H,#Qsi[IMЮNl~-O5-tdx-/Bp*+&Mڽ G)*@^{6MimTLbDcV͵!^(d+'OI3rz疃F‰~7.XoOZC P(AV~|CA c{-/?jռJWoCYBp0Kr_*yt6'h`ztO,OzMBJ3(UKxAaaHgut_2fD$dZY/'yi:)oiœUgÀ-YMˠ"Pji4/Q7|v0)K̀/=&=ϲ6ߔv:_Yp̊J;[*ϲZ69 s .I8'@b< 1tkz$ \f Png9@ i>=urD|Gp,l;N \ 陒gBV.OlzY]Ι魻+ P: :#>ok_ìtkƫ%?/B>(V4^0Wq_)%cdhkhAXP-ZpxK򚱉xjlmgc92-p,U^d>:˖VW:0CgҰUGl8Ҁ _UE"Ks=n$oD5xW|oD-E&Zy|٦엖Av4Z9t9 ce3j'Gu H>X͓sKCl/SBpdZȹH-$+W$C{6nO_o@ѩoZ +L|܈/6 :YVeh;wե܆LǿF!|la$u.:,%FG!&Nf$M_Ww8 dƣR0g \ivOW{Xl`_>._JYOnĽu'NǩgSQCغ2NᭃkG|$f>kdмѧ`^U֖L\W_kBd! s(Ϋt^|%`lhϝ3Ŵ+H5 ̉YqԻ7|ꌇNz'u~~',嗭XԔj11dMgRR/N5nH ~!4ҍCgT*{t&:0kh˹LHIJUV"(,=`|ċ@|2#Z.QZ&x 6Tʮ*:(& XW熪}wkƇ}^1ƞuR ~?ve9}O1x=~t"3 1D7qB#<,ͥ ˸r ,gZq(/ *o{I~,oz^ܴT)a c\l[.Sӈ$9c=e^2Eh͞u>_d^͉M;*N#`>*.hf ;Х{KpJ=fI,=\YXܶ@BnYBn|MVB%hcM<Y?MZIB Ķhh[ N/:QvKˊ^h>cǕl࢐=/ V9c^uE\5խ^Hȏ{6XoKl#D愎pͫ-ԛ;Ԙxn,K茪="QV+ڭ| `ޟLtR9ޤȈQ2){:`ŵeC?:/ W\8+.i<8e&azm~ Ʊ-utkG Jwbxsxrk a€aEJJw#Mի¶GSu MxizdezzK&XjNE܅ԒG_oM_ УHW1c*(QGI?=:Afq@\OU4t'd;|<\zug{؊[c?_8J>LRY(.̻}q֤p3oiW:]r(=/v2Q48<ز~\pb,0˔T6?Rzfgh~=%W6r*KU;'&+ɸeN.؉T2>xFբo6{%;ih̘3Xg<8cC~[47ŗ!j?#Z=27ۮ:WH*%o5g*H$!c0paNQn[Q3#^ij-]槾!l, x$)9]bwiyXINW zoٞ_CcY=F\yx@Α%.8.D8v~7R Tp{[%HK螘-W&jrfoTUeքFMjA}/n[1f V1ev9m:=R_׊[9NhWzKLi:g##y [vB:"<`½ݨnIDw׎a2l19F `;f}m(bpqW%?ad7 !r@2 npf+͂@bQ*Af*%tJsζ$p6/Ј;G\gTc@p8S7 C -(l@ IG~"2>+2Oξ(.fLfE,b&܊~Nhgp頪a(41{B.a ?yA}0c201snh&XޫYбMLAD?h7W=}с]ԌPBUi,;EcBEyv~`Tvidck.+(8W(y>'Q}٭9 [,WJLDCsaݶDRO+W(uo0KO{mtDjfK~\$ `{NSCfs|ì!]o<2!>[4C[fl,8HiF[IFD!&{%P%)Vz痶lAS&jXR`Zs@J2 @76#BP}!uRKZ bη--drԬ}cCU 3-´b}LJ5\ = x m7Y4r k`6j A?E3_s| me;SBy>-b8)Qɫ$st! 3U-'| O{W?UpcR:$o$؛+> tsu'(gzQFGo;}ӃsǻE%\p !TNdDgd)y2[js~ܒ;J ;iz5'21"0 ?Jr~:ΘzjLQxj DEbm unX{a^{Im"ˢlBeY`T·_;[7o(Y˳waD,7DBsw1YeVeS=٠\>9v+`1RtON$zHHܢ/[ 7DP@ҿR1H~0$A-D٪Ic<'> ;$iw}*^8iY  ˰NFv,4kN(m H'U_ĩ^bɹ4yEKW^+d2:Ia5@NPA23 }6C$._'PFk`Mo JȻyz3\xeBk.ʉ@>lc%%ÉVY5ɂ7q<4 +H,rk4&:g@x|hůKb!NEby%3єON!yťtR_Qg.{B lo*J/UJKb_r JyM>S&=߶*rrjR%Rarלh‹fOk#q3OC Y W6C$.SCvE[zPK B%N \S r %ܺoIW9怸pR7ﭪg ct%مsr_\*|1/^^9*ڷ$ֈٗBhc e$ { ߣ6B- n݋$3WumRw>?R "(`u-Iu:lƓ] ~>G vl&Y{1Q'%Rhmwi,σv-mh󙏙?d)>4%>>' @ Etu8l `1r! XiY#S@ڵO,EȦ^L{5WOKe;nspdrvb%!!Ax%Н`wQ87|{wJWֲ/‡툘VBi):{u``-t--[A'$z0Ucoa4(ɚhyqyjC(y}yM6v0QYK yofyn(z57{;Z!>+Xu[Yˇh!d孀{J;n'G)TK:ր=M2 IfJ0D]創p0$wE(#WB.frb-kiccj.=;\8(Vx e XW D$&8yX7r ;?,JCO<R[g;}mP˄q/92|jz`Hueі+Am֡gE|YϺ-A(8|< : c#!" N:Z)B4gyV[U&S<>{3,Ep"@ E'JFW&&z)vVs̅,b9 %[:!^[+Iϵ Q,ƞ?{Ȍ^ OJ/(ˇ">! -aJV,Kf:Z|Uc)}[e>ʟ117r ;ևTsB/ QY3|쪫6ǔ\bLT8l2عwTz!&h ̊qD+`hn۪ޒ ΑX\;u~(S仴l›8<ēOR¤z(֌MB,;O{ІīFF [&`4 ݕ)RVX3=!lFZη,kY<>>g)euŊ ԫHUژZƳɴ ?Nvct)YM+xO;pHT_\=W%?X∮_J:\~"~G*`dؼ*WSa@|ܰO|h)f 0(2VQ3p{IUC-T_ P@Rݡai)\t8a"_T l.\(6;T,MU4ȿ& %޶mn :Od5qe2T/|EoEOW\TWHGH}=x\$֑~6߲MfT#(awU=JŇ9i].1לG3sqJR:G=o!|D~X>F4 +0=felxtt.\o5@eVQ 5J # Vrv%&01:mFhAQi8g氣rT|eY䨶x;Gż a@C(ŔqeғIb0fEF#F]Q/+waٖ"8}SGXhb 9h>ҢiTm)\1e鵔hn?R) GEprZɽ3whGfR'xFx:<~/DiȈPE2`x8Ttq"hQF3=YG&Qzu"'s2b-Zo\Șƍ *||dtGyJhIϓ^lu" !*0usTኘIھ݈#y;Bm%τ]fjNNJS}V uҙ'g/!pY|AtTB> 0ZAsWU܀ GZS`%5\]I\]¢:ZEmԼM'"$ؔN@2= 蒑kнoEɞkB\.jȠLD @hEQpM-D3n WQ嶷 w PFo|}ug$y~̪qPźIǡ.sd+ӕAz9PPk/cozsL4Is(c ikd34s`oK&whڛcf7vrvD}Z%Z?R,XIFXeJ=g[CKI*ppe%hCrD~Y!;eKjỏsK1Y42iͬ+H'{. ^*X.2{pi0feʦ.)csX;wR2 8pO>"4 lZ8LTg{0*r ${␵/ 5/; ݮO0_ɮ!l y2M#D?\4:6W4KJ9iW 7 ϧ j{dreVKj4DVt?$X-2jz <\ y=X7nfz$2?Z.(p_ӵ?\ӽ/#~!R &E |TA`"c6 ܊WD->WWis*f7MZ _zD?\r(ʀF8*,'rn7>T@?JݕݴT_wȈs~?GLDqw'hI8vRnƒe{r}wNنDN #n:` =bf 2P'KDяևce"|@i8AEŐXUg#FlH o9W`e=>t%59Jx1*wpS/5^h.on-zj{6wzfooߨo]h.~i'JTG5Ccs/Zq Y/5T{26̳L=)E0T5S;ɑ64cbn.fΆ@\6O3.+H&oOSFwq;}S /S)6]:{Yo:oa6$('(^]u[4)x2GMwu@ړ].} ܽ@/Mnn)c*v>g 1fײyggKi+&Zķp/t9:?YLɠ; k7 W!YF J?v#GΣF,KCSXIZ6nyZ%<~buj)5:mJ獆1_1&/bQ>םI.A 4urvw_ЎCCC@u!W".TǙjIc{Xb X U)eQYU^(;z9xiϧƙ 5C1Ժ+w s85 6N',>x amCPI=rMњ+q2&?H+ŢQGJ׾",$KEV|?IDǯQKu1JPsdZaNu9W42!|ѕF(a_FDޡH[A)(3Ǟ1W&1MW gJ@J{sgxDN> 4E1`s-0r.` Аr^x,޾vrt n κ`lG}#R*fQ/`G^B͎79Bg6YUMF~ RΘKc$%.ۻ02O%角.\p[+K3w.uv\cy4o(9g>gT-MF\ץN0{qw-\Nnq755$3dfjK9('k=mhc Jjuޗ]mΒv2BhчtƊK?> 4bּ!Ѩa|U#"(纴Kbi% .zpCtc{@erQD>-)J'+} fޟfQ7Q!o;"$y-Ē}.s:N5L~|I3קml̢œո @o!-cغ&)G`h~o7fO8EŐZqOCE`:3+X SFęl|cxfd=:G |iD=x P٠w)yf[1z38_7?Oj4`0k=ro丹};_iL ;e:`x2i^"e+.&=w&/ d pXRp?3<؟n}!^dWrU\]r rwCtCꂲd.jS9}Q;:R7 ewpJmE !af ˼˕/h}DA78(ÕLJiEb1(@CaëV +0sJG{tBLUV'pkkjIE8KPp,Nt$D>&V}5M6'2Ŧ7]'!L^ yڣ$+WgvQRλWlc(7D4 QX"Jh,nX_vH֚Q=y=jsqڒɪSGhq@zg{a *LEOWB#\XEӘ O?oE MzSQSr1'8RyeD5V'yM7`zߝbibfavu=4(p.|| +/:x ۪I~y+( p}ufBi;>ħ_۶HyW_l! >na qtd..|h @@g/[vS`Y1<+z2]$gw @5Ԏ5Ş]Ũ '!/niea,,0`78Qf}x׽b}30&7ɳyu8K/7=%DQW'"C|= ){WѸWGU#~MPl^#,d#քyNQz,vHZ^i8i4q5oe -MxHG [@=2;]Y$OrD(}OILx#㣜V[gQ'R\d̈́>,.B~pXުk3  Rk]*RL{G ~DdUQ#Y1"hSs\mfb|zdUi`qyVdIJIɋ=E7 s T9@]*v7~矫8zTϺQ ;* CCD(&9tfO`?K(NPF|;K)WG#}D/տJaL@A򷑬6A񮕚8Oh7H nJeva/ вqxN9mwF2dZ 8Mm*nz'Y|Q.8NZa,bɔuFEK,.Ik. !3${֤〯9Ϲz}nIW=0hX~L K5Jh=Ol\1C2fT-fԜℍz >F{*ҩ=rƇq=>Sw8젳 -^pRt ʘDk]؇v>$=p$4=H">G|~dHx`o}"ȮwAN'߮ON$؅[ː8`h&U&LJdCe { X~[}ˊΓ"L,iGBjT=2&i"ڧM P]r]"dP.v#'&A 8&H^qڦlD.7Dss^ѿa: W,sQ(H =MĦ~ gޖ eء4Tf*Ó Uu1`u6goa7Z=\B8U Ig3(<6:u!ۢ\o&f^ͪ!ە)Z50 $^7Y59͸E`/]a\B~}JD)%tR˜5^aGpj7>VQb_(ZBȵݐ0|;MtȓҤqs嘣Nt(y[i OryODZ̃ƎȨ&*@A9Oױ/*啗i?!Of 36&GBv[-f2!ԧ$f v 13ԮC!E`]~)ۃ+ҥOY)E!Y@#&vkDi(U(.*;=^yҷ&)7l*5 䓾\kZˁz&ͥxoO6E^"u}8pk1a!]Rα$p1ZZGydUcJYfW*B3XzU&>)0@Tg!m / ~"L@~S?]vZr,n_F3}=pIA:X8=Adω<[I041Ah}sTO$}IyhqO\ݵP+xЉ%m^'I&?atWZdP&~ܵcS]=Q.%(ƜmZ޼+0H_gv^~:TĨa>RΫU5uX7$jىTq~>8j媒WJSG!LݰaަL`ekt\k+iܓڅxW'dzͅg eR(oOvVTlfe],HU$*~C3wJyS90\L#nkqmsV΁#MQXPo雘5ڐeSvef9z9K 8C=Q8L"nM:zzVm8;;\:WP F$۟~R(Uk ?˱D`+UGծ}-פ\L;:Ԇ8ؘ9ԄE{2 |),C4s <Dnn@}E9H1nWd7Q;P ebZ I0IXN2D?jLP)b'1n D>MIEeUD.됥^]1R)qK_fp *AƼuЗj u<<ҷi*tYoS|=(/=^V3FtMٜ.pK:\-:fE3嶲В@9aq3dEbdq)lLƢ4X/ϖkGH8d;t Ym:w,^Qc5ESͳڋ ,/ZWU&fLH{E`?WnxPOlWUm [L/"dfՠF&@I]]9QN8Sz>̲#%x hC[:.ah#3I"ǚ_m kSF ebV +!v Lw5zJ; sO3H9C3E|5o﹔Q{_Vi(b#NIdBI 1u|`SѤRrdz 7kgTdgX,O|$DW{=z3,+t0MCښn`_22Dʀ*\coe& p+0sFJ4b5m &NkRwҿ+K{r9c$nz֧Jz^=ԶcqKعRmiY,FH ?jm8ȭT,\;§I)P̤|5H!NW}6Z{REL=|9I:}4:i GZ{[A0#zD- ௚%fFZQ{ n)-.KY|^!<6-8kz&Y'®}EVIߚthgŶU\c}!:\^<]V }~ 9}%5-H ! cQ=GQ[iXSik92- a's5(TWhog?~e~c-k%Eɐ蓊{z\I +tPe36 ?6U֗_DnjKdADEJrpE53rxю!r(d|w'<7f\nYm͋ں[+Vm_4\Wk?Z/'Rm mc;n5^Δw`TZ,c/6v=+{w?odUHK ЍaNuږ,5ޛHۯ&[e46W"~aXռ:+LTR)ڹSn:d0y?;E>1hqA, )iWu3R2VΛzߓob#bJTZd,Y˟,h^Z7݃ p@B5f̟DDأ6F;5UՃD3ˠMLrQMq-Y~gdG*˖8!z IK ZO%FHvXO%7*i6>Vzb_P"=. ]>Fk >eeeTCS=uNՕk_G@7瓬 ^<̺eSR`u>єZLUUh.3*xO_H:bz{/pZ4"h!fuK-$Pdh>]V1Q,}6 Τ-Dxi#J {w?2ZlϢ8iP]2/!=ޜ7\}AnD3lXMb}_y U&D6kL08^Ÿ!+Q23 ;CY*lrj=ghؽ,T򞈍_ cSl%i/%ǪM_o]ՅՐoR, Jxqt:; EAw8 ;Ѵ*+ Vn^ؒOo?XRնe嘱ڙ{U`6RC\B OcƥY):YBHPI=W9Q '+} ϵg *~R LLj&7 ur.c%5rDc74n#2IcB$زwY`s]1}>[^ g;Oxb.0 ~18]9z>yţҝJLP~ !F(@O-?] N9HwJ|PAu2+BK kq^ UOWu3nfWb~3R60֭V/s$2,9"2nPQL 84OZ ?kK)9;ӊm4LtY:A=Ϝig'r=TjD*\ xvbу"SL]h%~; Yp`zLMb}T'O']Y/>5GJϻ)^,+c݉<3gVlj 6+}fڷA9E}JY&n6 n>?94 { DwjENOFM|וA=+M#:F6,T`R?=KgEw9#KjD>!?ϔ{p:iBj0SkSd&gH D|l` +ajႅD'3u0yM+Ea5tg˱\uh~"<$?#ok)*+.?eΙ=Rpe1?̸LP}'N;GSot 9x{6baY(q$9{U* fs=0vduC+py$e@- $vV%f.a7n9-"Oĩ˪X䋋(hx*{{u~G\%`CE1FGF'W()M=jAuN KP5h< tEfJD0}|*5dÑ m-Ny ~l)nȁe>t_n!<ёTghⅺ ɉljJJ .}yh(6Oa<'DO$>>QfFC Bytt9%0:aPHdj nȈ> ЦUu^Tε䠡ʫ#i* ^4璕r0DZ\ؚ 8@ATE>x'3/C %?Taj=K|סY>k/ظӰ^{ٗŧ@$˨%zJS[,B۟Vå`5[M8 j7n5"EWjF:"0gkkCiE<jk9% X Jg,0ܰ6­dR `dL| 得 ||Ǽ O׶Z6ѸJօ1f8SLDvu4 `I + Ө蕨75Bariٚ)P̩;)ȹ|k݉F0?Εj8e ڵee_̈Ůtsi35gpb.hۦ]FatN{vQFR 7lvz _+5?k|FK78q(ۋl0S6 EfC@<Ҧd3#K;4abv1fa*/km3F8X5\ pVAEJw=tH<"= xW3>6:؆UuEhcwK=+|A5Wp?Ih?ft`jA2r-WeƛvfK\g"ah}OB+Wxeem4bȺ1B%aXH5iM+aB Knz=>lY1uGt %pig!{!>? {U;2eV`gi\{@o\i} ġ5UE{+t V]@a2m2]{h.vYOLD1qANu F}:x43q2Hc+-B!%'*}??rb# l.-GhNI mrԝbl{Hw83 E2[Ӧҋ“D,7wy$lJQ@W[|NI [&$3˜vwLj DgSs;DB `!){G)D!dOTS̷eʗZ']`ff4wNlPBUniFɺT`sM70V 6wz2u-ּ}=[+}P2em@Gd:ݯmҪĀV-p[Fj@G Υ `Ft2E\_?9= H GD>&ݤm񗢼juΕ"8kXkd}u.^D(E?*w=$-yMHQz')6sV|_G5ADEJzĐU=Z?겹1LeN%;"ȯ(lڗ !/,~D> `  bAʤ?ѓCNߘ F3r^>$ #8p@E\F+ۍ=o5X^xSg,XbYm©&V5~fZgGy_>ieԀU^y@V^PR+7RtrCDR4NM,I*`gl/KӪ{-<0NU #NlLE{ ^uRѨBb]HL{B: 23ߔAf-HIaWf)gA~&ϵ'n"w@~v8kŗx'(;Bk㌖U'G_հV0jFXQ1[\CJVLrf>B,,8j˼WᗆƟè(Zq aag@ %EBx ((ؕm ڥa|^Gy<Z"F`|z'xEczDpsI.*^L|{#+T49NClrqPkU̹HOl Y5US"W>Tl:+ S-*yen:F,~ߚ4xno8z,[ #氨 ^%HjEF:[8hĭ w{,$Y/F>C4_4}Ӽ<2XwPP5+#COGGFDZ\.v6G ܁#HvMo.x+xdG ;T '4P-%N}}jc]N6h,zǵDd6M&4ep4'=4UQcH߸6"*Suȷ9/֒.YwKڃ #-K!Pߓ!"zW 2o}8 $>k'xrUdܽUa3hڣeu}*/ϧ6#ZRx6As UU/bmP`>"6:ZedBǔ/U vتNP0BZNe(^3f8UݣVwt(!pՌC6idF/A/!=D[: j__?QW[!=NLQat]0>K|ɗG`U=ZRwnvKQK^$򗯕TiOKRe9Gu}6N6!7G|}ޙ!éQ@[ Rn[X |j{{&j;ʼ 2ߪ,P&hof*i:vk}kXLgtפe޵>~86%$t8an? rMFzHJ֡5q?fj-22C}5"߀A9q^9*AKo9묁#jp--.A325آg^*D䣎Vc<c_9>`N=݈lxch0J$m cp:g'К+QGD0Etw w~weuZjޤAǾm̱nFmAP{2Kåt&mdoZjk7{{? xWAf;ƞ G\Ōgञ;/\E!z Z˯*iZngh=aVYЗUԺyp`^ 7^d>δ˃-zցݸ)Dpg^km9FHH˪C1ugIgʮB/cg2bxxqHl&اAHDD|01/ɲ ZRչ9Gb.s} 1^p(Zw\^#ު^3i}aCzҖtiµ}BpStZJzE%Ôй5DNg ?kWp=1uĤVPJ+#'?bRTr~LS M^UN˙A{˔xNLt^V#M ަ÷9$jmr>&16|ё׶ Hd;nAJQCĢjauȖ )!9ib9$=ΞMCሦ1-1>]w.q;̓=C>X4W9'j;k5+K~6J.s\]2z8FߤB}gu>A]}(l^GxpYXx?::s7'k6u|9_;_ Ae-Uw<~ .Cv(pi} FkS*Oji~?e;bA0R,%o 1P=)(ՙZО|l$6A,{虢I1gU@c#T҉ۻk8<CQ;]!y+xΦAԽ[jbP{x ~r"CNGȆHl]甂FN?OKkڢE* a54q#Ùv,VLzmPIUq0>wbKjKr_'pI9hJxK=(<M!A{OnTur;`kVo4KRQ2vdkOš+d Rͅ]6 ?G$CJd`V㠟EH/MywCоk`HuBT{a]p+۞eƇ&KY7}W"ȮƄlSVWvl'ͳ УaҜu|O3Q|;;,mY^*ӿ6mxQB_tL4nR 4 ŀĿkwJqf wku7nJO2&ë`+n]&Ӯ aX> ޛ% 1Tяn*l0N[]}!9oʹ RŐx_zk>\I̱E%)Q4d۸R6%tJLlr;:.؛DP>Lz˳Esi8z Du@L`xBϞ^Y%U|x4N$M//C/ahGxلZ#s: ܏q󻹍W0ZlE5~8ݱGzle\rDSBeT>S Cn ٺpv1۱x7} Ɯ_f~⎯s9jȗ M컳lRHW3iG^J lcMg%#Ŷƫ.-^b󔁸tMfBWJX=*RPP%VTj&RW`B)ּ7T`m z>QGNԥb" Mm|I{]kcoP);!&:2+ĝ軡+=ԉzeQ$!yއMVbh.dR!KT=h u185"ۖ`+й.<~&2[GJd )ͼ) Fv-JvΠA=cUʞUUQ\^++ )FrWk <nP$Y%;`]i#:gh$a$J/7&7PBxX3U)XKLKP3ywj!}Ę۟C Zwc}ebЂ3?>F;j@YbF ,wY*9xY*&GPy3.z:Ӄ=TvOg@xrN 7 c1v!">i6%>x ݌˷MfP2Ѣ} mg+'E:֟6k* 'L1;?Y IdrU {3[Q?%˵\IXPijƛ@è6y>:# [~[6,gQ'$2Hs)ўp{H`y=~CVQxeJF}Aͮ!Riw;x?(g'e|ks,_bU]ŀ:9 d77.p*iVC&q D9e8t_vc6#^j%k  3[ 0b:B|d 07p2b_sY1k0 ]ZAݑq-BH +2'OH(WZ}GasDjf{" :Q6K>g- fZ26 ϕed_ެ+l D̈MY9%D2O(.]4#f2L'uAvvr Z1tih.>48z7!;÷>5j7>AMBv# Ki[LD Kh2On 'h$kuԋS8k .bv Wg\|_-xY=] ǷH $y_k㌪P1gJ'pK @sX WMaϼTSs%v>FOW5J<@!q-Egf.c6RUGBcTiSӦn -h͐,->S鶖3GNîߠc{q.>pЩ> gԓ`?P_|Hpv`T^ D8c|Gef#Id ,[s%u<;;S.rB(=Ot0FahNP;7bIj?8bRbn.-U0Ƹwoկ# *ҟ?=¾|a+η[@ VkNDȪ:cx:Ls]I;ӢiOYtOqKX,C#a5=?`B*b2D˽I 8&D8Q}n0Jz|*ۈmGuU٧ZC555ﲪwY'G,g*ztK;MboiHV[BG^B`(l!&O¦J%ǶPl;C1S6[;!")? E-cTj2Oe,?!NQ6c*0{ N0 LJ'(%Qˀb~BVdh=[:lGyKe.:>(k;[vw:#!gR9ט~B$I};Xu'K4r1\ ;`1(42|\_e4 )o"?ETfmߓ3𐦮r'%v&?ani{Aw߰]D |s`}'l> *)5FD;f Gsu͐.H\ÇE nĭB^b6{#¦]Sa@Gtz}l *;w[ ûv{OL[$pI43Fɝ`G%a,TIH ~/қ_ix 4%?biJ?܀g홠;TV 1Jp'ɩБGy.r{+'r elD tnՒ CvsQ۪v*B?Ѹ L ͙7?I|bLYbZy|A8 p]&m7yIwP]LODkQwG4!C$I &7W;aH-FH ~9`]]~/fO]@hbr/vBS"̤] 'lrz+s  M xԤ23}|喝FBOcM6ddpZT糑%@U. vR(1\KKOޯԨ@\C%*E.:@ׇI*Pq8{C$0r: H^Xs$TҚ(^a/8u~~r[4Ďd5;8*"vڞ/&`r\y`. bA67?\c%O{O]kAs| g<02l3=1M]ҁ= Ɵ00h* ?*2_ۍ&@,Rb&8ǎ5GׄW0cagbPn"T24}SqwۘՏ+?"&Ge0tnT:0CDTCdd+|[ux]zuy%>%[I A%656e,0CAIB ;0v_hj&_(=o^e$YTiWЌ9&Tt=r:UbKs*c{@ ovt|/{vRhⱺ3]ݻ.b\ij<ڽbx/Ċ{X{< 1j[K=' UPnl^--Mg$C\c݉E<4;SJ3 xuSs3ח5:881b3Qk6tK6XSXLpICfıbז;od,ZK}ON<.2X: ?@a*+Ն_)`Ñ5}۵np{{X9烎A"D&zm(HPXqF<͸ȳY3 Iu5?\Ħ :n!c##O9'(3O;"Z춫$0((;WI3{-˷)D%IGA⩻Gn*Hh+_pV"z/ 97|k 1~Xp%6~B0vta"9;Tz~)>#5'(i)n{D܆yN Z6H ip_ G5? 뇛 Eq<~!bO:e$=@6a\$ y=QyĴv-gsGlBK7c2w&:`TAн Xn b|#|+҅k?nX/I6#耕ar#n_4;`.=Jx)!+b)iA<%bSMZ nOSURSiWPf:p+nUWƱrtd?,GrzxlԫKKi\㇏x ԮCu2w"(5@ 5G+, 5yw?V,7L{xՀvpGSP<Ќ_y#,YIaM ȕ&e'HZCxTSp'0O4W-r4.!=,wf4M\tSOu9_)EA')3d1M]՜U8F"ŘJ8f-|e$YvZ1fdxZ͂0@y(ms2\e &bBH18_ޤ4%sϙ&ߢ2¹VWKV;$U"yY|T޳͡-p qFX{1 ە^ Ly6Zֆ? bQHf;B=s;ujbS)ǏXuE[M(p[Տ’*w1L%I衈5b"ch<AzUf}'ҎQNdP1ntDNBĄ)a\ Uʫ>4nalVN >zlq42O8tCC"<>4r [\feT$SCA-}x!ȳ~bm_| 8_#?*PB{Pםs| ˞a#?"xPN8EYB=$<1s~=_?iY[}`:lыqv {DNq'S^Lz30J~m|I)(荃C $B[X#ԉi93Ti*Vye@j7Iw%O JE~>2" lsHvM:]>ypݶ~_aVg0VQŖr˱~ ?eh++wi wF7dD'>)$TƦwDM')‡0 "*E3 !5S?,.{ ߧAwVAWB'0hY<4d. q)CtPS`0>E[HE fm di@D(~(^9 ǹcNNsH9dUuat-Mgk2a AvE%?N!K/O";a )jMhz8+HhVTj]/a}my]=~WK<[ywY]ҮJT>sr%%_@c"NVb '81X_aE}2qYL/LaⰨTav9\T>vϗ;t⮳!V92y[@cA`7b#M$ fEepՀq*zwNl\tXcY@Ez'ažV 0;׸_>.ݲT4Ȳ#$ҎD)gv9u>~VMRn`Fhc{s/*p^)tFo;Ic#Ly/9x#KA@]f&EI*g.A[poÙпu-6H$jh}nd=+ۧ[66u* p/zj?Ph]r!Xȍ%Õ<״N"ud9z<2a9N+&'F[sƬ5S? X)B{4T>p=SpPHi?duK/Sy"8?Mf 66GXg],% F=M9NWJɉLT6!N10?[VsƝպ]T"ng<[tLUzIY%P"=Eދ؍R!LlM ±W_/>,q17ֲ&TҸNєapbX6 =:WJ36{"1v23`[; mQ* ɟcI]ua좺Z8Mv ;-P1ʣk< ;1lM c8s^;WIzK"MVd-#_`+sȇ<b.*g@$a,Ovk=UC9SA䛒MgV8<͊n.ܥWoT h8f_ZkD dOT0g~}bMAsY$!_ER.rc_"߿+^f䰋. :ejw F>nHMvAdB-u߅v*>} KݓG$])Vesv4TlŰz~ L% q- =g;^ T嫂+1Єڗᰔ~y)],v,PUH)W(jxWRaY*ԍSX^#+!M KIZuo|$mBXl '8|\4A;(>y7=9- o4Sq-7=_cQ2X%O^>>0VaQG+xj0yOi563 mxq"& Mg+abo1s00UTBM kR#m]OJks-c_)Ha.[ 6z ORڦnGMDl> i>*m짡m̞ Ax+8F *R"5s_-8k*̊q@5I]ti>4'x^'SAĉg{=Xq6s=q[ 69'7r9D=)}gjxT5wؾ6{typ*0u IbT%fG/v~N gਧh2oD)/#M@@q<%sx"QN8MҬ8*0Ga'vdF0zZ#ҳpۋ8Mc=ϊ%lE8PHe&,Ipa8V7H6|*f2֟JL"=1N( <]i+&AĚ4r&kdZ$IHƈso []/i%blHSePBUWd[rupaG (n2#n_zox : [P/BqF`\A?'ߺTF5 OWJkuG׺D=Dc*6/=ӆQmo}BNܪHS;[?b!Ȓi >N,L HosZ(ik*Br+_J>XMRR6^PW:(=j|Un3,Q֑,X}ߎb;ۤY[hˋ,}L3MH _ŨU.|@H7'>}B9g`fĬ8RCjxHeֈE&g8U29b5** 5ڏ8Ba2GU.0x$7w5ֈE{u?{u(4TIt(IZ@Db4 ?2I:o[=(V\ȧZRB܏Va_$Pb${p,bWؔ%S)myV( U}|7v|/1dQ~!\f"ZojSs_劄$2B˃? mлԀj<9  Hխ7?pE~Ŧ|[uA(gz-]hN!~["R/G>[ DR\4.v߃lYZEwaPpAS`ӑvNx9֋d6?OaթA*>'K:aV܂sc/Cz=Ɛퟃ-a%]T1x FlTbOUN=tAz󃣧1kb#}q3ui%hHj/a;5BY*G Z,v1>^yU+rv:GxHYY-1']}P]V ZLD:M:A߅?}*S"#3(nX>]g* _ꆷ1fTC+7t,O`#F|LNqP p (j>m]#`O򥜓BoG]DgmZGD)]+F͋SǃΏ߸^E^JYg/)\P3!ObL*ks αlYae $m0| lPPBC~ɯ80kDX=; A(=|#vڣS&1Q9yv΋ 0;zD'{!Kߊ!$"e.% T\slK&_- ŊUE͟ף [ϳ 0Iٖ< .'ۻDJ$IlC{Рߵ˦x6 1x(4\4:0Q>;31!ƞ"@5 =1PudyT14inhd}ejUk RuY \C3Mg /81 QEgt>z9K'mi&r9= &H9DW#<_K\[vY"[B풓 !TfHhn靏WR76̩N#xvu3O9+]8־)\7} }Rb8f 49v ]fH@J}DޭoDT_Rx|ʇCέ$$y2*kcDwG na)$'a_D5NBH4/vؘ|TcϕB:9k̹mM&sv'mYtT1.=g#Y8, D[C^''>"=ЇRJ)DUS%ipuBp$=˲͊w{\nUd$Ξ]-X "mGhUߢYW&4~$pfAUwYtwSJf n[ 0Xg4sbVYބuXmGU~4ϵݴne.GWH,&Ew!M\a\P\.BS3'ISWU) 7ROhK1&􎯩. d .Lu!#Ci^\QE%9m Z:PmgmOc/>/0J*l&aA3B?/&{KP6BD2=f0m2~#hx-uC!^jT!Ejィ[#"x8yC吤Q9J5|W0d=ʯ_I!Arg"wORΰz Dt./6q/ ~#v›TVU7V ]5G'Jif 2L6N dDZE_x)ZNt\Z6yR/&')ԉ'pp^Rpiا&O:şdNP 0;ocf!OR_$l^<_~ԓcEYR|`وvkh|OJUt3UK7k_''L bVgR+y֟$.V4gZuprJnjXd0 9aikENE+Nߣ h^<ET\+9ыo*,50R0 صB-munCGB|b 2Peоy>=nFRCto@5RWa7f4ػɦ:PR?C{\e韎6 l +]$r}B%JNeRМ΂;_$'p0ԪlRʍB%^i)̪aQ?;|yx4|UV1PZVڷ(jp*lFCh-RcgĈ8Jۉ2ܾƃgڛڦhөګ}ʏ3gWQYF.t%yǮm/r+nedOQi찡 =x$(7 ',xq!$C߽`I{&z2Zwբ*er`/^F Rp%y2ojZ#9Bл7pEa9~gsSj#a,/G%g=0 );0 JFThwv,?uq;Rnjt>dDМATL9'IEaSe5m#E}D%V&B6ii9BXSm,(yܗ"^!gޓW$!Ȏ/K;rSc( Fsr_{U 'L #m B md~rig=؝Dj& 3-mʯ2o뵕ג XI҆&e%v= noa ~h)QTVV%[%GuIIsC ?*}Uj9Qy/Uw3Ue sz`>(ms0jD xf>.dZHBK ăh@{^s`ÃT9t)yV 5٥Y=h7yL顫V,Ʒ x3rwF_` Uf3mk0cB8Yڞ6ZLSvBl](sG!.Y51dA p]qjf, `$BRe$s|RV"L, 8q/kFJ8+=ZOOF +Ť[5L! ,.0vDo;t'8F!ܲ?z>b^y]XkӦu}D❤a h=gXwn??dCWm^.AB0w-hmD'>c^ ąTK~g.2#,$/{x=#73WA U !quiRd+%-%,oCGB2hL ^@;ֆS`k?f\MQt>+s W =F[H6Tߖ6u/#'n'WuFnvƾizA|b\Szjiqءj 1D$1- U={k::S.bA" hJGQlԾc}i- `VFMDA6=)m,GKUY˔[䃪TkR=*^n3ΖZ9SȔ')slma:uSQ m]z V8’kEDI@􋮺~W0p7 t6OFtﯼHs/_ Rj[KD6Z#F j O.aLCdiݦyA79Y?'֡sFU^qNy#RJ0"u- .xu~^l|\plԓ$t^8A*o5bȯl= bXy+z( BVt pńe[#CF~3G2rL\O)k0Oj^94Q[2\' ,~9t 0fOys+юGy0t[5u- GaWa N_Ty#).o_ذ(@PsbEgw]% M; 3(*5Sݻyz wXeڛ_8=Y{akWgl X6Vi_{dayWH\iRM9νU#","0}pѬ|H@Ժb3 i{suuAs\nc۸2 2\!{˔K̽?42~b|  ";-vv [rJ%=YlrFш +~&tKaY_joF<'q!%BTt"Wp"SW@G,\QŽk py%7u3}!槿 ?T,H7=V}O%Z`ef꒦znA;]ˆR38C#=zun΃y8\:v'IیZMEf힛 iCZx0u%4d|UAH2W@# }G]:4:C鷲'Xnz[=l?\I>P02?I!#zYaBFK(Wb_GuY6\m:I(DR6!x*2 G$iEf$т&1jJ\-TJz]BG6_X\3U_9k2E|[,*%-B瀐6]D^|?LEH"yndt@pg4|1+UCL^I'ҿ֋4aI5 d"ĩif[xj ]ܣn ^"Dv5 {tJPH5 Dش}Ĩ<), `OyM%;m껃=3A[zzjVuŐ"ea顒lDXnXJ_U}t?4R፛uc@/,Sɿ Mΰfq'Hݓr1.GƋ.pP/!KDg|s AsnlXFy+a%v`&LI1yNwôEG5ץ O;qH_g9]873oJ+"eWˮʦԱ;O+ P<WWM.ܠ&Ț'5&˭;L<˜cK Ĕ49c5$ 4@Gu￠KkT M\䫜bGi%YLhr "?_xg.`yLJlE9%R'z n)viYUd렣[I_.+&!$eE | HwZ (ia ʷ7nbA+;:1Af~4El`zCKc:=d_5`:Gtx^Wƞ ew {G]ɼ8~noe# +2)`%N}$'Ah^'s#%wFd*?!BV8$TrnN Ȁ(`Lp!tS|A.)Diui C;0]2նAPHQdʳ%77Yݺ$Y7QyK]#v<̘-VSʪZk@ oA[Yc0(n =rz>g9A*"c0w_֕0Q Vd>[,܈Lw45 $fTX2:,򃒚)  TBCm) Qڦ1fYGqYZ%OaH6.]=b<b .dVUeZH0EA?gxe] s@[>]C&DUߡA{C~/Cc3KznQoboFuRAnKEy@mU2G-`hUIxn8` ՠ; zTF0hD6^e@ck:$;:P?Fw,sN9iڏ.Ŕ~Ɉ?r AIwO'$ 9M ym`MUHz93 X 8oa,ƀ2!!/\wX,\dT,5s5(LAfJ^چJLϷ q2@i\J_7njGD J]t\E}8 [0@1pbhi%|2~gbCÈRuXk?ue6{{K{!gg4JLq7o |nu^D_dbˆJO}V[:Q9*WWw$o)RP=Wn/B|AłYBjA3YY /I-;pB7ePwI\ܧ \/A(ζ1MJ~R8yvdU/O`8Ru[j^k*tOEѦ*~AZecnbJA U(P~"$ۢ1}ZI8Hf f&ZP:G0DN|܃=w_ D7 Uw(x`X ռ-KpЖ:oyoՄ.' ib+XOfQ 0P?.\ekfǵRrLAC%.=`l۝%!o?@Eؖ{ >}g#Jve9?N%AvΏ5~︎2j 4OHչ9?)3O`̖çFOZ͊7;Qr+Nxhۈl%{(SguvEMa'W$n~s r Cҕ܈m dR lӄ1t ~ݮ)idԜΕ V׵LS> 0:v# O @Ocd4Kt3Z%z+]ZG1PY9i'RwG7rfZt,>HS&9 )nK3ʽ/9vɕ{ʑ@0/9\grT'v^c#.),بtIRPݯzg'yBJmkGHvd'dvSQzx!\%!ѬV0Nm^jD91Xڤ KXHR~oa$ud&աK>Q,GcrH7/A+ HTޣT%S8EvkIaf1t 0Tc0Fi+!tH$dY2,^$uj. !crN%&$y6l+z&Q셱;NbYh35Fvsʋ^yE+Qg1N6h |\|;ui񦌋}v&TVAVmpG_l²({\1i-E#>f;:WQem?M^/>׀Ô %/ǾqO.$hKiFz6i.BC?Ō>6Ž8({ z/SMV<'gaAXH'"Fr{‰"\(Tm$~֏!c}-$Նm]·U}^Ǥz ~Z&֒/:2̷Ny% 4䀂 5VR?)RLNzN,w}4%pODgd ˗[Ʒ %',<鑀4vnpiLexkϘ(MnJ$tVnƸ 9Md{D#%|<4S?U Q+/Qk%!ljZ 偸$,PvF ݛ#>*f6(8UaG7.Q$L8RΣ /]4JҬPFOSڱ3ik"fN ]/E}!tu1ߨp~a3h$ٔ·Zˍl+:!۸O|eu}Bm_B&7jkjb ]m3} 6  | )6HOR2lZ61dⳘͺ,[ nsեK)}n71ӆ  RUKVڄqHj?J&~@q¥Dz @QUФsP$q#&n .f1XeEW:mt0GXyGtX3= lXxg ӽSpZ(>Z$,ITΐ⠼RIu9xs`y1=.E7%cE<ٵυv"@> C+5lӊ qY}$ʲ:o$ΟrPεP$}Xq֙-'#J K)M#y,B(Ծ?b ̼I d#9C;,{[c,i$riŸ#;to*jc;*1T%,S @)[4ҺwM0Jx|fDڡkQ֩<_C:mGF& i"Gay\;p?;ӕk3 ISk]7:B9+ꡂ݊1= {I} ȓc zxh3k۟.]#cy)HzPQ?]ot#"6xwn"eQ &~~v6v:f%v q}I58 3GVٳg]%(WrLN) D˽ %E2>sm;6Ű^XpBZw a֝dOq.!IXOX6^z6yV[jC p~k|kڣh16tʆƎԂt݄" [!%x9&n<=QT'ǸJyFRĄU/Sj1N|Z3{]$R'J^wqHp 5>u^d_ؐ֨yn8z\2,|^Ѱ%MjdsuN٦BJ%T? EŠq:*fb2b.YI<أ-xPNfDV!Z#qkp0Ɔ!X5O?3cb-Co%.{bG}Sx>qOlliD_=iSS첓U*SHxa㪌:5 ng1//TS&TR M:q"wv} p]BqU %IF'8d;N䔵ݭKWn -'&k+/!@Q w?r!qѽ Dj]-{hvOhup?د \*'q탦 /@DjkNhmKo̝#p.j; ξ{n;aCD>fY\v苬OyF7E'Nןv]LV@0: W#}w9L\xE|jz-*eF"IٹKNt0U}uzM6#:g!(!Z j'mjvWIS3V*k7X%V! V,)~%śhZ0boUDk\q9$4o ۃ TR!;B`@U;7G#bmA4xAh"18χqI@+R7ZO fgU~YK@-\?7"(/յ|:vj7RҜέ]S.RGVa,AX. KD,ۯՊW =" -67b[dpv$$&XpTZ+At|"_Wi|ij#} |r7#п\bc&"c(RӃ9*'X $oU*ΉE [=kp9R-J_^X;Ѩ4^*>]l]IG\OY86Qb* u qʠrkjP}Ua>;P;2DrVC M#Aª%OAd:PfyCl8|~!rN5`|s#g=Z>/ PKHؐ}|MoD/L P+6@!R7eh< ͿiOBAYMfY Օ@= R0J&:a 2 yCOB44F|'>KqVo3i3/~@oa4 ԨјQH>C .u=gc;Isιyf/7vg 8k_hdO2ѣmI DAsL[2)~8N3;籫˅KrU_ Mv[]7bZ| w閈wn²QD$Kї-Ȋ?vCXTJ4m9QY"BSp ,)&ZI{ *zϞ,(8Az; 6*xBw`%Yf26mJ({ DOaVF|r.R TVMqT%с(NH7z4v9,B%96Sy@o W%90[-K'Q.͍MU iA9 ? r7R8y+hOawmhП'KK`e}ؑ|-&e_,ԕE2DUFf J~J/ۋ<2%t0aXδԺQ*,9xR\ ˹O?j$HT 8+aL O0.V5Q `6 r8qxdRDp(05nۼ fonprrh򰎻}Ԛ-Q̧ǃ5Kdۏ-3јK Ha͐ԚW85;] C&b%= &ea"FUrS)vי?7pn^n ֳyl敵>A&ERZ1=3 NHWۺK)19$}M#tlB]0'vgTlHFVO<hKYn8R|pL%)oAbύ[TmT\s'񶦂Q!_.hZ O Kr$\jui$&ոTTa`~dRת߰Q$\b \5RY!\ pW,\ڂ :ngm!7dЍ0;m:ch ڊVSOy[jڃ`Ol9jߡLfOqwӂ}.CA|1JE$L2=@ݰ _( Z̮X$RQnE3hW:CJ0^זs=mfɝVPhw\a*#s,hbGESb@+Φ14svJ0=LL1R IOS]q$ɴr7L%۳Oͫbsܮe(ˊ4`z 2 õUQ=/EE pndj)YsapOJ{ o WFmnF_˞XUtM-9Vwe,1K}#`.LTQh.7aN+@xGQƊi_Ɗh+ޝhBC@[#}U!.WO0p7pPf<K}doC!,7ܪl51.=7,f E+r3 Ysҡ rZ$Dgߑ 95(x@ -P 3u>ȻOXW0t{81$yj\Lg]{*_K^.wȝsyϲ.@\8Oa_Wpyx G$IL2 (DՖMW^ L֡'٪zxl$\#9lnWՊA/@/5KiZdDjt dmWܤ$pu>MEYRjʩZo~7$t,V$L|>ͥ2!9B1ds}81KmY6~uԛIߊ|\ G宄>v+ Yd;>BD bg0P;jW[t$6γ5a̧-]ɂOY\w׉du*<E(n%E%ɘ@c͙] 5&ӧˠUi! Nu| ɺB3urBYd|&z>7o:o?fHQ9DBٕ]A wStTtSKO@j?a~@dHBeU tS25iQ12-L|Ib>Z>^vjAR{2/af Ǧ|@iAȲk YgɲP}j5-| ;h%: dQh*d3m%+kj#/EYc:Ye9ڂT˲*:$+ FYep\rIwׇwqTCgn䳞aV)Kg^jYOaN;m?D!Cb|8$O? gܿkFY.xH5Dh:@R~z._Ѹ8< *B`߁4c] v;oH/xvY1l2Aen0e*{L,5p `=--@d2 kB25k51|/6x6sce'Z!s9JU]4;`dM\?PZ[Puex?7dzm5YV0pj~,j3O.[gC_ħ'~ ^NGt:c.dv -M}` <—Y L٨I4k! c槽̓i|vlB'HlJlqf>+\7\,LĆTOvjʠ`:h53)Fvj7.' 1\颺*?_S8xsEQr +;5\eR:*"'V<6c1wa/"RgctmH Mz5$$0욆W;A|Ze#֢!mF2ẋYHWrV͎lKpO}Fg&,ʋߵݨ %=͇~m408gO)UJ`*]Yf9_ïu[YuZB*,9,@MI?C7}h)Q^Vp2LWe(4b"p=K-=%1D|uG: aFS=qE+G^c0* bLRS(قG1uwۅ12hDj x-'2P+󱒭)u5radkqy#)3naCِ* v S n(\٫ŐcNNcݴ1yB{ClOd"P n/B@X !B,*ףp`ȫ")5=n$v;'BV:dd-JY_l aHȸs ZYnT:AmY;,ڬteNURWj%cB,tfl ul+Jn:sAVjV.IbvP㑈l}NB4"h6wUkр^}\Ȫ-p/%UE?r-;z5ć;J' 9;ՌZ /a^}(S70C̯U+u(-w@O $I=v JĄ8m|Y>G2jY8am"N:-s:BRԝ%U38@w%3&E%디JZ>AWӮt8eݒ }J㙎1@ 5]_COusnSwtF5i;@St La#u pbt@h#ޖW0N蘨Œ _le\v.aᛉ>w?a{DX*[<_IbynmcJ:jބPL1@Fն=3fi+^_gfDЧ*F)7C|lK*sv**La m0 xvNc(QvgH;TEY蔄}.ЭB[{.Uzizk#|0Sb<4IrORHmR(_[G]]I4L92`{筙0 4d;-̞+p[GAm+G-w)+*©(-jOE pAU5q_EӬA(67Qf^ӄ܃Nm$.6˒J8,tVX-(:X 4-v2[nH)Act(N0bw8*S]P|~ |"``$]aft%aUH@YZҡ+i[VE,ꄩvOw>^9R藝1SW~Os}^zb{͜5l-I|6&Rj؈4_0sPM4#MjE ; ? `"&e؉EZ$ ׊5 3Q؉AJg4 rO#y`i@O>¢P<{§9gU "Q-np-40/8IqCy&QDFKҎɩ-l)>gJ{u_` v->Ɍ!36-fLq 9yP0`,ύ30E,q<=Г|YF*$~knzeeLG^ؼ*jCLtfIVK~d FӫC"i 8aU^^E9FʞDR48`m\s+/Mƾ/2~X{tuSg[P2}]D8DO_XދtN¹?C|A44PLٔ^rC%?pЦ՟WH"?o$>s=3ޫz P0헞n ' r :%ѨT?-<bCe޳YrG 2׎}zz qꏞܛ\tdAMDqd+Qg9a,8WEY~"lՇ[Z Ih Ah|qG ]-_щJZRyṘ'j\5p ӈ:-v[ %O E DI@i ir Jŭ[<%k邞4.ll L>,w(ߖ`ɜRRt Y? ى͔N/EnĆ$ل,%ڛlwmf *#ȣ:GSҡ~t;TGQVd0%2@VrY;$1}0wqhss[c:Iz`lR-:?*FEr+~5{ ws4ϣ]2? a.Ի ^V59j `N'ր#W/ө"SઞͶP,v4l_B~'8/zR"N+s\Nb2S&&b-)Ir]AI$!+ΐ'>~d5Z?HŘqxvGdȠ-#G#d,)ބQ|;&|=m\XܻN}O!T0_ =Z61fMȝ=td|t#rH.. ~/LmX2;6( S<a n+uE: @l[UYYH"5px3g0* O)#"~'mIu#? ְKBMKQm5Op)ϟp \c ?q*vڛ-CbMD{|@YE(?+!=L;w!\e= .t'kwk4:{`AA5Y-xj/ 9THӾ;bPm UYZ׼%vZn!~3a;! p6StTI Feƕj 4>(>u}Y'4xIhn 2کajP-;YC@fQ\wl3ܔb|i3d]L>fV}h2jzݠ2O2Uk1iǭ thϤt߆]޶Iˉm{B,:4 LݳAT IQf*LMDض@ܥ Z)?hŋ! A"ZorBH+',=v\ݹ%`dT eJ iNҙ\n`+m֔dB h,׬"s1uB3iĝkYJ}r״o9נMK8fS6$!>W N#7dZwS"֑^()PL!FDQC(Bp$:Vo{Ň4Vc^O]J57JC=rdg)Y +v0P q;u,.FuX@b־ivctmcOY߼a"o qEOL$Ւ^z!Q~oJaqN(g-78'_,C$>3&-’G18{al d_ġ)X\s|TQ)zYmYHzoK_rCB];`:ﵨKJ wQe6P*DjӋ4p#:0Mm x;ѣIN(dzcc+Vd[Myݍ5ڄJ ɮ692M "OӨ, w@)Y byXmBjd ٷ|ڻ';󪚷9|)WϞi6T>"vAlxSV'w R%'e6tS!Ƹ[9 ደK}RO0d 3.BģU3o"~J"\\hDc6ۻn GjIZKXI)udvCMvk-0Uat.vg!fsI[vN^6_r{  eƆW.}2L -H:xJaͻwd[U/T{/ow~G_GHeFa98\mY#I` 1Wxxӡuڅ\4M"(7rFaq U~!ys?!4-]IHo5(~k&:!X؇>mhWꪾ FUz/)9ZJ\Dp[ժylJ+c60jEeݎtՓ/oF1+~V3 EM߽'C}X1 _5R{Ttij5$zPMnܺ{5ήakYbb~Z#r6 ϕ#-$8q-.<&`t-q1a+R 4Lc4(Vhi#Mբ|SM |z4=$U8?\O,=SVG/gC et!zCWm^z(e;7KwpWęǷG-uU6!v>y.,$[}hӤfمEzki E5K+W^ЋԼcK'0~Ƨ4kZhU,u ͠qspbK͑6_7ª|,؟4_V$<9v_ e`5 =rc$mP xҔ|#AURuO۝ϣ[/FӸ}Z2ݯd)GYQ()hFa[˼"EB'-+g1]OsL! qьY \+ M|ɫHܗ~ 5 ߨ#뙖Y?gM#I\:ru>gP Pڥ,X#Z-Mxu-3 Pk|/8K77@Őkbce?8څDa XHkj*x/PRYZhKRmMWDs;?`U*'K~s!ႥpBY|V+Ҏ T!ir+:~O\aՙ4q:#$ꏌJtE[= |n y11Vg \-=s4Ѯk~ /d/@kn`3RTOh[' 03TC7 kvBAja!Ar2F:(0 ? Hq?ζ3nBP ""ݮ"ڙ|X\}qXsʗҼnqw+w3V-n=C-*67W& = * E[tO:skAGv\|GMnnΉ"F :_;3;e w}(ٛy:N d'h::%(+,7 Kaä#Tv$sn^&-nƐUTW?앀!]Ofz5˭6뼠Dc6>S:{yYtꍯX/z|- +v!!PieF&u@KC$J!l v(.wp 詚(8M|x3w=W_ TaUhr"*+vݠ u/7?ۏS=4 ɮ4T^#UPBj(׻]_Qf _XO{Yl[ӻJF(wW n \4 bX gg 'qH]h& 3Yr7:SM$ҕmޮAG_jVV n^fEIq3DTlS캣:Vj|~s ,}x^X| ۛvzAϮٽf)G8ic՟Px*A&ҍ?sU2 dț'ד ΒF ӭ2@Ry[z):*,t U!չ0K=q&}(ya5zMxslGƄ)b/+%}=~h@FmnB ni |btK=*вIJ"Ы\&ݱr^J˿+7 AS<.ʽ7Kj)cOOZ KWZ]$p$7z8x>*`b|ef! j '2q7N8 XBcfրꀍK-[apZ`ƵWۈF?dE2a?qCV< lz'0eJ__Z0mvyX?C4J*! p*(-Lncе./KW+dƠ &FHv2 pТ4\r|"(a,Bޠ:k͏P%3a#jg[؜X|,"3^gTf}`: Es#=wb?Gu.hn~hK8EUcX+]ү7u)"[Í&ܫcң'QovOڶВ]Xmwv'%bq^,-!xkqA Y>:Z< MuxwTO)}Ar |Y|ut/Q8Tva!Ѥ#IF!dhrq_$:'O+c B%"aJF^49wU'LBGV}ZL`v]uɷ*,臕B/0;E 䔚[E 鬯Z N&&Uu=t[D<^+ -cz< ,@yq8E%#ݚ~[ݻȵ[ E3Bzi%];PF!$߿.G5o+@5;BD;>ͪ 7#;Tȧ3MU/OWSKprWⲌ4-tuXTжAͅvBʣ&ׇWɰL yf󎝊Р`ՙv='O)qX`j}rrm71i>53 5w<ܦ(˾;šO~# SG fߋzBlOqpW7a s3n;Uq˰:l.3efm8!ъdڶon_^8Ke:Um)Eq]|i3Z^]mp$_,bg={ԂI@Ü`- nke.3=9U4ꜢO-M $'߄H[&f`(ḪO|ΊWKDB!`RM{)b?򻎙)Q3?vHzp7Lo>,J;h׎mڌU >1ھ(va_,{E_ iM#3 }?G%)=*i/ hoO #+pN/!Ң?Hژ4J܂\*Xt^6?XHo5¿5gz[BhD }*;hV+c~w9(F̗M,me*B!FOW˽X~ѩ_ ;}c#sꯣޙb6hߊ:._S 0v}&)15V(=O(OuHF{:lS':9(`IRX,?`$@ '渴ٕ_eBޜ@'Axr :@io mz- ie]4l@u;PHPE<2qɝr`vsMtZ1lx+:wΚ>Wʡ)3 ÕUm$][F^mJ&?>JtG1e6ݫ^|K헯W {B*(ܪf oq0 ܭ*x_Z8QwHНZT!԰81ylB Fc X /yDf&G.nheTZ .-wV(# qa.wb/N#Pss&^~ݿã)_m!qvW4u\qݼ9br'^NTnHsMrퟁx]m2 mTm R4!-wz_B:  .A*f'F&VG 0B=xÏ4 )S? RY!6HoB;QLpp8}zY^~oݍV=/? qWﱘ9oHW4oIdAkSUQXnewpS E+:Őj l>4P[ [[BA‘z"N$M"^1ⰓA6źPʘlqq''{ˠU8f&P+CbuNq%C<HZ&hhB _P3afg f-p(%"G,yTC}ph1_Mm#+ 8qcJ@FOz )ݎ6n1TVSV|_KNADjFF=&PE  q,#OHo#?Hc2:/lm(w|Ѫy,z-=jiM0HHb͊ " Jf1zy` 7Bf}R+HcU#Lz`W$fN>  ' >C'+1*ڍk)oȂ}{<~pm9-͠v(U_Pt~䰵B\$қ>@HAx#,ӄU~c?%""~޿|C:tߨ#. ެII<7(,dcP95a 3>ZBlCAn"vu{PVmwk✧ௌP@L6Z=߅~,G Ɉr h㏹#g\ +iXږ5OAU+D mS- 6_UπNrt&B-S]9rt)#nEk{P5;t|g Z_(A.Q!;n] IXıe!z*Xİy~'/Obѡ[k.y'\6Q<5l#0S};MZd`O7,ewv9ʊ̋eKa)RhԎsr&pѳ#~O|׀guNޏI%eʚ!B;SC!U#=i*t `t\QD'$| Cz28ӋM*|0<';E; W2ζB{[+`EJ[3{ $RY|s2(ٸbwm֙Gf2N =eFm$;.\<+_%38$ǓIFM#uJ|żMHD5--7oj*i] MF GIՌeNcvK/۸%O=GN"E\'Ӟ?<0RHIZ2`l!X]%z&jC̰VS`XFjskժ'=:3)MuShšA'%~ S>9i)J~^8rjU0 '묽 B9QΉpSt' ρ Ӗj,%vJ`6wxlrh!|@3-6~:6S?S([8*+ yZ'RE=)US+HcH+'xf?lM d(ʻYGce(8.倗F;fWI`л=NnOZ⻵>X{OQ󻩚h8NIA6b+qG}G-uh۟~CɊ=3kn 1"Qpٸ4W1PXrY`&7D )8a͌2Yq"FQ7܌cáQM Gޔ_`%s0)~w DpǏ!6PPi3dyg ,}[crp簹Ar֙i!s¶fviݞC>}ݱÙ|[z%83of njY iƚ>ݰޫʟzjR- ޥ٘Xyt-Q *[OԞAoch28s* tK̹\(伀<;:!e zYהZp!T9'F|_~{A~VYH=OY$h#sdz%0eQ9 4Op­w l iq*ņ/>ᖙ2LuHXVW_M[tML̟.[Ap"{ x u>-ơ vQGg Uo1\ Ʋo{CARu̢vPvF$f _~[gcJnI\z&Af勝,j$~bb/*)Kî]j~<D6'\^HTd>zYߤCG($X2c#?0QO.5PI*rFӃ Vd% : oU ^*sJh=~4xOOb;kXj8iۅB2 "iCtz}0%no'=ie|)1x2e50Uow°i 9ك5I ~9/n-61~ֆ[A3X}x<3_$4nk(=Dd'j=plJ4{Mhʴ^ȳeEZ|\N>XFl+;'m41{!6ko}d,֯Jme5ϭ-չB8T v{s{PWhqX_1 3XF(IޟqL#鲶nNn$L$`3uuVHһs9ӏpT;;b9_=?jj;]|S @%]M fg,ЗM>`V^jVs%\5c-0f]1JMS;8NfA5bvmS% >O=\{n kyJ_Wmp%FzDթcSRĒoI֠>/>f$yY^ _6gD`15g]FS cT$Tс6;@ }.eX*oR[h=|"Uo:rE`FbX a)SGZN@Ε " سfvx/Y)Qk(dx\NG Ogݴҥ&tVQ(mqO5>-!/ UCվjeVJf8%aCFZʁ46ٲBy !Ybɨ%зE#b+03` /I 3z7d;3gK(s[$h ǯs710&/N(;yp(A!xߚ$V{QcUm^QeuB[Iv.dvYYG6B)שOdSvJ1~cv*+?;I*DN+]/t -;A& C:?:Wcnþ5H VC|),ÈS/]ܬ~/ i݂Ik" iQ qRD>,7xñXIRI8 Mf no, ^ Į%Ed}*'^<];YխJ=T$ɡS!9-g.9vѱFEzsC|I_|@)W! sx9$` EƭUo;ԕ}WB0CZ޶_[=ܧmEHI8i) 2D>d8Qo'.a6,%%bܺf2ܩ8Qo &q0ނݟ5~r"pەeܒFK+ُ N{=ٱ\0|dCZ}J# K wGPyI!ǞcbFȇQjmqH'qʷZ >*z[B= #ױ*5;Ce7ڮYI@ Ҩ0ԯaܢktOJSFZR94%B6f؋7L*O~ '`@uhꦜê4mhZ9tI*> {"n²/9Cܹ]sT.R$̩~<5o>znzBȓ.< pn2>s⺡{YG}_Ѻ5 A)ϊz7"o}СKPZ sG@TN~MP)./)4=|wZ=yEt<#U#elrC_2>ns/crzW)s"~" 4'{Ǎn`6kn$ĉ%p]]t&k6y|k5P2#H=FHG2~=č7֪Ѝiq8wr4J(}ѼyZ4VpӔ_^z&~k9Y/֠z%{TD#t=j"^TF q;vI@e|YFQ?Dq2 45S>BE`2'ƛDW*-?g,a)-b38um%5))g"P'5WAqE]cߚǼZt蟚Y@E|]ENn-EhglTZ&į/ÁsT`=CsFMFj6wAc`Dcܔ5v@ ەVߟ yZ4"ؚHWӫHW4WAeLѧz}A~e@z8LQ}v>:Z6l\s)&yDu:?3B 2ޫMuy$yB41[sQs{8!-Bq-݇z}Be"u-}%~Q#FN`I6,s"׿l(KCp~:vq7S63%FdKC죝W&̢z\*_ Wx38(@jF4 A&r !% DnjBNM{M%<dܺ>k}^UOr)$^XPrel]*761hؚ>ϋhnݹˤrcc~9ð3< ~GN/{f'B}R̩"gTE3#c$!X3'X I JHWj