| Type: | Package |
| Title: | Functional Utilities for Data Processing |
| Version: | 0.3.3 |
| Description: | Covers several areas of data processing: batch-splitting, reading and writing of large data files, data tiling, one-hot encoding and decoding of data tiles, stratified proportional (random or probabilistic) data sampling, data normalization and thresholding, substring location and commonalities inside strings, and location and tabulation of amino acids, modifications or associated monoisotopic masses inside modified peptides. The extractor utility implements code from 'Matrix.utils', Varrichio C (2020), https://cran.r-project.org/package=Matrix.utils. |
| License: | GPL (≥ 3) |
| Imports: | data.table (≥ 1.18.2.0), RVerbalExpressions (≥ 0.1.0), methods |
| Depends: | R (≥ 4.1.0), callr, fastmatch, listenv, Matrix, RcppAlgos, utils |
| Encoding: | UTF-8 |
| Suggests: | testthat (≥ 3.0.0) |
| Config/testthat/edition: | 3 |
| Config/roxygen2/version: | 8.0.0 |
| NeedsCompilation: | no |
| Packaged: | 2026-05-10 16:35:19 UTC; Dragos |
| Author: | Dragos Bandur [aut, cre] |
| Maintainer: | Dragos Bandur <dbandur@sympatico.ca> |
| Repository: | CRAN |
| Date/Publication: | 2026-05-19 13:20:07 UTC |
Functional Utilities For Data Processing
Description
The intent of this package is utilitarian which explains the relatively large number of informative messages displayed by most functions. Designed for large and very large data files, the package employs data.table, list environments, sparse matrices, iterators, and background processing in few places. Nevertheless, Users could try thread optimization, memoisation parallel processing, as these techniques were outside the scope.
The package covers several areas of data processing: subset reading and writing of large data files, data tiling (horizontal and vertical splitting) - suited for data conversion operations with local as well as global hold such as, one-hot encoding - stratified, proportional, random or probabilistic data sampling, data normalization and thresholding, substring location inside strings e.g. peptides inside protein chains, common substrings identification and location-tabulation of amino acids, modifications or their associated monoisotopic masses inside modified peptides covering various representations of protein mass spectrometry data with no pretense of exhaustiveness.
Comments and suggestions regarding tricky situations are provided however brief. Examples should be run individually in R console. When possible, suppression of messages should be avoided.
Author(s)
Maintainer: Dragos Bandur dbandur@sympatico.ca
Authors:
Dragos Bandur dbandur@sympatico.ca
Defunct Functions In Package akin
Description
The following functions are defunct. Where available, alternative functions are suggested
at help("akin-defunct").
common
this function is defunct. Use fcommon instead.
Calculate The Number Of Combinations Of String Covering
Description
Calculates the cardinality of substring family (the covering) and returns valid elements.
Usage
cover(x, valid. = FALSE, wplot = FALSE)
Arguments
x |
integer, length = 1 or character vector, length > 1, or character string |
valid. |
logical, default, FALSE. When TRUE, valid substrings are returned. Requires character or string |
wplot |
logical, FALSE. When TRUE, displays a plot of combinations versus number of characters in string |
Details
This function finds the total, the minimum and the maximum number of combinations of individual string covering or returns a subset of valid substrings (i.e. elements of the string) by retaining even transpositions inside the combinations matrix.
NOTE 1: Herein, the covering represents the substring family that preserves the order of characters inside
the string. Hence, the use of combinations instead of partial permutations, n!/(n-r)!, as the order
inside each selection group r is irrelevant.
NOTE 2: Very long strings may result in memory allocation error when valid. = TRUE. Use fcommon instead.
NOTE 3: When x is an integer associated with an existing string, x must equal either nchar(string)
or length(character).
Value
When valid. = FALSE a prettified named vector showing the total, minimum and maximum number of
combinations for respective string covering. When valid. = TRUE, a character vector of valid substrings
longer than 2 characters each. In both cases, a plot is returned when wplot = TRUE.
See Also
Examples
if (interactive()) {
# 1. x is a character
# 1.1 A string
x = 'tyrvvsvltvlhqdwlngkeykck'
a = cover(x)
print(a)
# 1.2 A vector
x = strsplit(x, '')[[1]]
b = cover(x)
print(b)
# 2. An integer
n = length(x)
c = cover(n)
print(c)
# 3. Valid substrings with plot
d = cover(x, valid. = TRUE, wplot = TRUE)
print(head(d, 30))
}
Fast Identify Common Substrings In A Pair Of Strings
Description
Checks and identifies substrings that are common to a pair of strings.
Usage
fcommon(x, y)
Arguments
x, y |
character, length 1 each: a string, such as a protein chain. |
Details
This utility identifies common substrings in the x, y pair of strings by isolating sequences of
identical characters in both strings which then, are packed into substrings and validated. All one-character substrings are removed.
When y is missing, x is cleaved at each letter producing all substrings longer than 2 characters.
Value
A sorted character vector of common substrings of length >= 2 characters each. When y is missing from call, a sorted
character vector of valid substrings in x of length >= 2 characters each.
See Also
Examples
if (interactive()) {
# 1. Check for common substrings in the pair below
x = 'dvvmtqsplslpvtpgepasiscrssqslaktyrvvsvltvlhqdwlngkeykckvv'
y = 'mtqspltyrvvsvltvlhqdwlngkeykcksnkalpapiektisk'
# 1.1 Common substrings
system.time(a <- fcommon(x, y))
print(head(a, 30))
# 1.2 Cleaving (slow on very long strings!)
system.time(aa <- fcommon(x))
system.time(bb <- fcommon(y))
# 1.3 Identical results
A = sort(intersect(aa, bb)) # common substrings
identical(a, A) # TRUE
# 2. Different methods for valid substrings
x = 'tyrvvsvltvlhqdwlngkeykck'
# 2.1. Combinations matrix (slower!)
system.time(am <- cover(x, valid. = TRUE)) # valid substrings
# 2.2 String cleaving
system.time(ac <- fcommon(x)) # valid substrings
identical(am, ac) # TRUE
}
Find Substring Locations Inside A String
Description
Finds all locations of a known character substring inside a character string.
Usage
findLoc(
subchain,
chain,
outlist = FALSE,
named = FALSE,
all. = FALSE,
which = min,
ignore.case = TRUE,
perl = FALSE,
fixed = FALSE,
useBytes = FALSE
)
Arguments
subchain |
character, length 1, e.g. a peptide sequence |
chain |
(named) character, length 1 or a (named) list of such characters such as a list of protein chains obtained from a fasta file |
outlist |
logical. Default, FALSE, the output is a (named) integer vector of locations. Otherwise, it is a (named) list of location vectors, each corresponding to a chain in a list of chains |
named |
logical. Default, FALSE. Output is not named. Otherwise, the output is named |
all. |
logical, default FALSE, returns the leftmost or the rightmost location inside the chain. When TRUE, returns all locations inside the chain for each chain in a list |
which |
symbol. Location to report. Default, min. Requires |
ignore.case, perl, fixed, useBytes |
arguments to base::gregexpr |
Details
Wrapper to base::gregexpr, the function scans all chains in a list of chains to find subchain locations. The location is defined as the position inside the chain relative to the left end of the chain of the first subchain character.
Value
A (named) integer or a (named) list of integer vectors of subchain locations inside the chain.
See Also
Examples
if (interactive()) {
# 1. List of chains
chain = list(chain1 = 'alpdxoipoyloiekladxoipoylyl',
chain2 = 'kdxoipoylyydxoipoylopldxoipoylac')
subchain = 'DXOIPOYL' # ignoring the case
findLoc(subchain, chain, outlist = TRUE, named = TRUE, all. = TRUE) # named list
findLoc(subchain, chain, named = TRUE, all. = TRUE) # named integer
findLoc(subchain, chain, outlist = TRUE, named = TRUE) # the leftmost positions
findLoc(subchain, chain, which = max, named = TRUE) # the rightmost positions
# 2. Single chain
chain = chain[[1]]
findLoc(subchain, chain, all. = TRUE)
findLoc(subchain, chain, which = max)
findLoc(subchain, chain) # default location
findLoc(subchain, chain, which = max, ignore.case = FALSE) # not ignoring the case
}
Extract Encoded Variables From Encoded Split Or Tiled Data
Description
Extracts a single encoded variable from a list or listenv of encoded matrices containing multiple encoded variables
Usage
getEV(en, name, ...)
Arguments
en |
a (named) list, or listenv of matrices or a single matrix, all containing multiple encoded variables. See oneHot decoder for lists and matrices containing single encoded variables |
name |
character, length 1. Column name as found in source data |
... |
default, empty. Used to convert the class of extracted matrix to 'dgCMatrix' or 'matrix' |
Details
This function includes code from package "Matrix.utils" v 0.9.8, published under GPL-3 license, currently removed from CRAN. With thanks to the package Author!
NOTE 1: If name is a source data column name that appears inside other column names, the extracted matrix
will combine all encoded matrices having this name inside their column names. Although the extracted matrix is a
proper matrix of encodings, it no longer represents a single encoded data column. As result, upon decoding,
the oneHot decoder will report ambiguous decoding.
NOTE 2: a warning reading either "single-column encoded matrix for ..." or "number of columns of
result is not a multiple of vector length (arg 2) ..." may appear when extracting an encoded categorical variable
from a list of encoded matrices. Most likely, this happens with low cardinality encoded variables. The warning
signals that most encoded matrices associated with respective variable contain subsets of only one category (level)
when, ideally, most of these matrices should contain a mixture of two or more categories or levels; thus, allowing
matrix row-binding by category's label. One or more of the following suggestions will solve the issue: a) shuffle
the data before encoding, b) increase the number of rows in data chunks when encoding, c) if memory allows,
opt for tileHot encoding single matrix output, as shown in Example 2.1, solution c.
Value
A dense or sparse matrix of single encoded variable which can be decoded with the oneHot decoder.
See Also
Examples
if (interactive()) {
# 1. mtcars data have all columns type "double"
data(mtcars)
a = lapply(mtcars, oneHot, encode) # encode mtcars data
print(a) # list of sparse matrices
b = getEV(a, 'cyl') # extract encoded "cyl" column
print(b) # a 32x3 sparse matrix
c = oneHot(b, decode) # revert
identical(mtcars$cyl, c) # FALSE. 'mtcars$cyl' is type "double"
isTRUE(all.equal(mtcars$cyl, c)) # TRUE
# 2. Warnings associated with low cardinality categorical variable
# See tileHot() Examples for full decoding of a dataset
# 2.1 Make 'csv' file
data(iris) # low cardinality "Species"
tempf = tempfile(fileext = '.csv')
write.table(iris, tempf , sep = ',', row.names = FALSE, quote = FALSE)
A = tileHot(readpath = tempf, rows = 14, splits = 3) # encoded tiles list
print(A[[11]][[5]]) # e.g. one-column matrix
a = getEV(A, 'Species') # warning
colSums(a) # incorrect!
# solution b
B = tileHot(readpath = tempf, rows = 60, splits = 3) # increase number of rows
b = getEV(B, 'Species') # still warning
colSums(b) # incorrect!
# Solution b) could work in combination with solution a)
# solution c
C = tileHot(tempf, rows = 14, splits = 3, orn = TRUE) # encoded matrix
c = getEV(C, 'Species') # no warning
colSums(c) # correct!
unlink(tempf)
# 2.2 Shuffled 'csv' file
tempf = tempfile(fileext = '.csv')
iris22 = iris[{ set.seed(327); sample.int(150) },] # shuffled iris data
write.table(iris22, tempf , sep = ',', row.names = FALSE, quote = FALSE)
A = tileHot(readpath = tempf, rows = 14, splits = 3) # same as above
#solution a
a = getEV(A, 'Species') # no warning
colSums(a) # correct!
unlink(tempf)
}
Locate And Extract Modifications Or Monoisotopic Masses From A Modified Peptide
Description
Finds and tabulates amino acid modification sites and extracts modifications or monoisotopic masses from modified peptide data representation.
Usage
locateMod(string, wrap = "]", inbracket = ")", except = NULL, rmve = NULL)
Arguments
string |
character, length 1. Modified or unmodified peptide, or NULL |
wrap |
character, length 1. The closing (right-hand) side of any of the bracket types ']', ')', '}' that wrap the modifications, such as in protein mass spectrometry data representation of modified peptides. Default, ']' |
inbracket |
character, length 1. Same as above for brackets used inside modification wrappings. Default, ')' |
except |
character, length >= 1. Default, NULL. Punctuation marks or characters that appear along modifications
and are needed to remain present in the output: '-', '+', ',', ';', ':', '=', '.', |
rmve |
character, length 1. Default, NULL. Regular expression. Digits or extra characters that need to be removed from the output (see Examples) |
Details
Although capable of handling most situations, it is recommended that the wrapping bracket type
remains consistent throughout and the inbracket type be different from wrapping type.
No extra characters are removed from result when except = rmve = NULL.
This utility covers most data representation styles for modified peptide. However, clean data results are not guaranteed. The template for letter casing accepted for modified peptide and for modifications should match those presented in Examples: upper case for peptide and mixed case for modifications.
Value
A 'data.table' class data frame containing the unmodified peptide, the modified peptide, the modification site (i.e. the amino acid code letter and location inside the peptide) and the associated modification(s). In case of monoisotopic mass extraction, monoisotopic mass values populate column "Modification" as "character" types. Multiple modifications (identical or not) found at the same site are listed as many times as they appear at that site. Unmodified, endogenous peptides are listed with no other information. Empty strings are listed as such with a warning.
See Also
Examples
if (interactive()) {
# Completely made-up modified peptides:
# 1. Modifications
# 1.1 Default brackets
string = 'K[Prop_A][Met][Prop (C)]PSSABCELR[Prop][Prop][Prop]FQC[Carba (C)]GQQ[Met +44]TARP'
a = locateMod(string)
print(a) # with extra-characters
b = locateMod(string, except = '\\w+', rmve = '(\\(.*\\)|_[A-Z]|[0-9])')
print(b) # without extra-characters
# In this example argument "rmve" contains the default in-brackets
# 1.2 Alternative bracketing
string = 'K{Prop_A}{Met}{Prop [A]}PSSABCELR{Prop +15}{Prop}{Prop}FQC{Carba [C]}GQQ{Met +44}TARP'
c = locateMod(string, '}', ']')
print(c)
d = locateMod(string, '}', ']', except = '\\w+', rmve = '(\\[.*\\]|_[A-Z]|[0-9])')
print(d)
# In this example argument "rmve" contains the alternative in-brackets
# 2. Empty string
empty = locateMod(""); print(empty)
# 3. Monoisotopic masses
string = 'TAAC[+57.021464]PPC[+57.021464]PAPPAPS[+162.052824]VFLTLMISR'
e = locateMod(string)
print(e) # with extra-characters
f = locateMod(string, rmve = '[[:punct:]]')$Modification
print(f) # incorrect values
g = locateMod(string, rmve = '\\+')$Modification
print(g) # correct!
class(g) # character
}
One-hot Encoder And Decoder Of Variables
Description
Encodes logical, categorical, integer and double type variables.
Usage
oneHot(x, type, omc = "dgCMatrix", verbose = TRUE)
Arguments
x |
a (named) vector or list for encoding. Missing data are removed. For decoding, a dense or sparse matrix (preferably, the result of encoding) representing a single source data column |
type |
symbol. Choices: encode - one-hot encoding, decode - revert to original |
omc |
character length 1. Output matrix class. Default, 'dgCMatrix', other option, 'matrix' |
verbose |
logical, default TRUE, display messages |
Details
This utility one-hot encodes when type = encode and verifies the encoded result (or any
matrix of encodings obtained with getEV extractor) when type = decode. It detects illicit states.
Value
Encoding returns a matrix of length(x) rows and length(unique(x)) columns or a warning.
Decoding returns a (named) vector or a warning. List vectors are returned unlisted. Integer(ish) vectors,
converted to integer, character vectors - to factor, double or logical vector types remain unchanged.
Examples
if (interactive()) {
# 1. Encode type "double"
x = runif(9) # numeric, length 9
names(x) = letters[1:9] # named
typeof(x)
a = oneHot(x, encode) # a sparse matrix of "dgCMatrix" class
b = oneHot(a, decode) # a type "double" named numeric, length 9
isTRUE(all.equal(x, b)) # TRUE
typeof(b)
print(x); print(b)
# 2. Type "logical" with missing values
y = c(TRUE, TRUE, NA, FALSE, TRUE, NA) # logical, length 6 with missing values
typeof(y)
a = oneHot(y, encode, 'matrix')
print(a) # a dense matrix
b = oneHot(a, decode) # revert
all.equal(y, b) # missing values in y removed
typeof(b)
print(x); print(b)
# 3. iris data
data(iris)
a = lapply(iris, oneHot, encode) # encode entire data
b = as.data.frame(
lapply(a, oneHot, decode) # revert
)
identical(iris, b) # TRUE. Now, replace iris data with
# mtcars data!
# 4. Illicit states in one-hot encoding
`3.41` = c(1,0,0,1,1,0,0,1) # encoded type "double"
`0.12` = c(0,1,0,0,0,1,1,0)
a = cbind(`3.41`, `0.12`) # form encoded matrix
print(a) # matrix resembling one-hot encoding
x = oneHot(a, decode) # illicit state detected
print(x) # list with 2 different data types
}
Scaling And Thresholding Of Numeric Variables
Description
Implements classical methods for data scaling: range, z-score normalization, location and location-scale normalization, as well as data thesholding through the simplest form of ReLU rectifier. Missing values are removed in all cases.
Usage
score(x, how, filter = NULL, ...)
Arguments
x |
numeric vector, length > 1. Variable to be scaled or filtered |
how |
symbol. Choices are range, stdev or relu |
filter |
character, length 1. Default NULL. Choices "positive", "negative". Requires |
... |
list reserved for User input of paired values, statistic or otherwise. The list uses individual
ellipsis arguments therefore, order of values needs be respected at all times e.g. when |
Details
Normalization (scaling) can be applied locally on subsets of x when User inputs the values in the ... list.
Otherwise, the scaling is global i.e. it is applied to x as a whole. No assumptions regarding the underlying distribution
of x are made.
how != relu. When ... is empty, the function uses the sample statistics of x e.g. the mean, range
or standard deviation. Otherwise, it uses values inputted by User case in which, location-scale normalization
requires how = stdev and the ... list filled as follows: the min(x) or max(x), or any other
value first and sd(x) > 0 or any other positive value second. In particular, location normalization works similarly
but with the second value = 1. Other location types, e.g. x/max(x), are obtainable.
NOTE: when ... is populated with custom values, all other arguments should be present and named (see Examples).
how = relu. This option acts as numeric thresholding locally as well as globally. It stands for rectified
linear unit and involves no statistics. It applies to numeric types that have ordering property (double,
integer). On return, all x attributes are dropped. When filter = 'positive', all negative values are set to zero
while positive values remain unchanged. Alternatively, when filter = 'negative', all negative values remain unchanged
while all other values are set to zero. The "negative" option was added for symmetry.
Value
Numeric. When missing ... and how != relu, scaled values using x own sample statistics.
Otherwise, scaling is based on values inputted by User. When how = relu, x >= 0 or x <= 0, depending
on filter setting.
References
Ancillary Statistic for location and location-scale distributions
Examples
if (interactive()) {
# 1. ReLU thresholding
x = { set.seed(223); sort(runif(10, -3, 3)) }
y = score(x, relu, 'positive'); y
z = score(x, relu, 'negative'); z
# 1.1 ReLU Plot
olp = par(no.readonly = TRUE)
par(list(mar = c(1,1,1,1), mgp = c(0,0,0), tcl = -0.01, pty = 's'))
plot(x, y, type = 'l', col = 'steelblue', lwd = 2 ,
xlim = c(min(x), max(x)), ylim = c(min(x), max(x))
, ylab = expression(ReLU(x)), xaxs = 'i', yaxs = 'i', axes = FALSE, cex.lab = 0.7)
axis(1, pos = 0, cex.axis = 0.6) ; axis(2, pos = 0, cex.axis = 0.6)
points(x, z, type = 'l', col = 'orangered', lwd = 2)
legend('topleft', legend = c('positive', 'negative'),
col = c('steelblue', 'orangered'), pch = 'l', lwd = 2, cex = 0.6, bty = 'n')
par(olp)
# 2. Location and location-scale
# 2.1 Location (e.g. "x - max(x)")
x = 1:10
M = max(x)
std = 1
a = score(x, stdev, NULL, M, std); a
# 2.2 Location (e.g. "x/max(x)")
m = 0 # the mean
M = max(x) # or any value
b = score(x, range, NULL, m, M); b
# 2.3 Location-scale (e.g. "(x - max(x))/sd(x)")
M = max(x) # or any value
std = sd(x) # or any value > 0
c = score(x, stdev, NULL, M, std); c
# m, M and std above can be replaced with any values decided by User
# 3. Classical normalization
# 3.1 Range
d = score(x, range); d
# 3.2 z-score
e = score(x, stdev); e
# 4. Local vs. global z-score normalization
data(mtcars)
x = mtcars$wt
m = mean(x)
std = sd(x)
ll = split(x, f = as.factor(mtcars$cyl)) # partitioned x
# 4.1 Local scaling
aa = lapply(ll, score, stdev, NULL, m, std) # filled ... list
na = unlist(aa, FALSE, FALSE)
# 4.2 Global scaling
nb = score(x, stdev)
# 4.3 Local as well as global hold
identical(sort(na), sort(nb)) # TRUE
}
Read Or Write Subsets Of Data Files From Or To Disk
Description
Reads or writes data files from/to disk in disjoint subsets. This is a two-stage function (see Examples).
Usage
splitH(readpath, writepath = NULL)
Arguments
readpath |
character length 1. Full path to the source file |
writepath |
character length 1. Full path to the destination file |
Details
Above arguments apply to Stage 1 only. The arguments for Stage 2 function, which is the output of Stage 1, are the following:
rows integer, length 1. Number of rows per subset. When rows = Inf, the data can be either
copied as is or moved to a new location
seq logical, default TRUE: read discrete subsets. Otherwise, progressively appended subsets
from first to current
dropcols character of length < ncol(data). Columns to drop. Works only when rows is
finite. Replaces argument select from data.table::fread
how symbol. Works only when rows = Inf and writepath location is given.
Options: how = scp, data file is copied as is to writepath location;
how = mv, data file is moved to writepath location
print logical, default TRUE, each subset written to disk is shown in console. Setting print to
FALSE could increase writing speed
orn logical, default FALSE. When TRUE, the original data row numbers
are shown in each subset
The main purpose of this utility is to bring manageable subsets from very large data into the working
environment for further processing when writepath = NULL. When orn = TRUE, each subset
receives a new column named "srn" showing source data row numbers. This column
is absent from subsets written to disk regardless of orn value. The source data file can be any
type of file readable by data.table::fread.
At the first stage:
the utility retrieves information about source data without loading them into memory and also provides the new function which, in the second stage:
reads source data in successive disjoint subsets (
rows < Inf) and brings them into the work environment (writepath = NULL), orwrites subsets to
writepathlocation appending them automatically to the destination file. During writing, if (print = TRUE) the displayed subsets are just printouts (class "NULL"). Whenwritepath = NULL, displayed subsets are objects.
There is a functional difference between rows = Inf and rows = nrow(data):
when
rows = Inf, the size of source data is irrelevant. They can be either copied (how = scp) or moved (how = mv) towritepathdestination without being loaded into memory.when
rowshas finite value, the size of source data is relevant and data columns can be dropped.
Value
At stage 1, displayed information and a function (a closure). At stage 2, a "data.table" class subset of data or a printout of said subset when written on disk.
References
Part of internal code for Stage 1 was inspired by data.table Issue# 7169
See Also
Linux commands scp and mv
Examples
if (interactive()) {
# Make a 'csv' file
data(mtcars)
tmpf = tempfile(fileext = '.csv')
write.table(mtcars,tmpf , sep = ',', row.names = FALSE, quote = FALSE)
# 1. Read data file step by step
# 1.1 Get information on data
r = splitH(readpath = tmpf) # stage 1
class(r) # function
# 1.2 Read data iteratively # stage 2
a = r(rows = 11, dropcols = c('am', 'vs')) # iter1 no original row numbers
b = r(rows = 11, dropcols = c('am', 'vs'), orn = TRUE) # iter2 w. original row numbers
c = r(rows = 11, dropcols = c('am', 'vs')) # iter3 the last subset
## Not run:
d = r(rows = 11, dropcols = c('am', 'vs')) # iter4 stop! Return to stage 1
## End(Not run)
print(list(a, b, c))
# 2. Read data file completely
r = splitH(readpath = tmpf) # stage 1
n = ceiling(32/13) # read 13 rows at a time
a = replicate(n, r(rows = 13), simplify = FALSE) # read file
class(a) # list
print(a) # a list of tables
tmpf1 = tempfile(fileext = '.csv') # new location
# 3. Iteratively write to new location
r = splitH(readpath = tmpf, writepath = tmpf1) # stage 1
n = ceiling(32/11) # 11 rows each time
invisible(
replicate(n, r(rows = 11) , simplify = FALSE) # write to new location
)
a = data.table::fread(tmpf1) # check result
dim(a)
print(head(a))
unlink(tmpf1)
tmpf2 = tempfile(fileext = '.csv') # new location
# 4. Move file from tmpf to another location
r = splitH(readpath = tmpf, writepath = tmpf2) # stage 1
r(rows = Inf, how = mv, print = FALSE) # move to new location
a = data.table::fread(tmpf2) # check result
print(head(a))
unlink(tmpf)
unlink(tmpf2)
}
Split Data Vertically Into Subsets
Description
Splits data into unequal and disjoint groups of columns (i.e. vertical splits)
Usage
splitV(data, splits)
Arguments
data |
a "data.table" class data frame or convertible to "data.table" class |
splits |
integer, length 1, of value <= |
Details
The smaller the splits value, the wider the column groups. Column order from
source data is not preserved
Value
An exhaustive listenv of disjoint column groups from original data
Examples
if (interactive()) {
# 1. Split iris data vertically
data(iris)
a = splitV(iris, splits = 3) # split data in 3 column groups
class(a) # listenv, environment
print(as.list(a)) # list
}
Extract A Proportional Stratified Sample From A Data Set
Description
Obtains a proportional stratified sample from any data convertible to "data.table" class containing categorical variables.
Usage
stratify(
X,
target,
stratum = NULL,
size,
thresh,
seed = NULL,
indx = TRUE,
dis = NULL,
args = list(),
ext = FALSE,
replace = FALSE,
verbose = TRUE
)
Arguments
X |
any data array convertible to "data.table" class |
target |
character length 1. The name of column considered to be the root stratum. For example, the name of the 'target' categorical column in a classification training set. This argument should always have a value |
stratum |
character of length <= |
size |
integer length 1. Default, none. Value set by User. In this case, it is upper-bounded by the size of the
thinnest stratum having more than one row. Setting |
thresh |
integer, length 1. Default, none. An automatic switch between sample size calculation formulae.
Can be set when NOTE: it is recommended that both |
seed |
integer length 1. Seed value for output reproducibility |
indx |
logical. Default TRUE, returns the sample row index only. FALSE, returns the sampled data |
dis |
symbol. Default NULL. One of the density or function distributions used for generating probability vectors for probabilistic sampling |
args |
list of arguments required by distributions as described in stats::distributions documentation. Default, none. NB The list should never include the first argument (x or n) required in documentation, as it is collected internally from each stratum NOTE: Even if |
ext |
logical, default FALSE. When TRUE, expands the output sampled data with the following extra columns:
row - sample rows, strat - stratum, n - stratum total rows (i.e. thickness)
and size - the sample size extracted from each stratum. Requires |
replace |
logical, default FALSE. When TRUE, sampling with replacement if |
verbose |
logical, default TRUE, display messages |
Details
This utility is designed to find a true sample representation of the data under current stratification
by matching closely the proportionality of strata as long as argument size is missing from call.
Each distinct combination of target and stratum levels defines a stratum. For minimal
stratification, argument target must always have a value present in call. All one-row strata, when
formed, are simply appended to the compounded output.
size. As column in the extended output, it represents the size of the sample extracted from each
stratum, internally derived to be proportional to stratum thickness, unbounded by the thinnest stratum with more
than one row. Deep stratification along with high cardinality and imbalance may severely restrict the size of the
compounded output which is the sum of all stratum sizes plus the number of one-row strata. The sampling occurs at
stratum level except for one-row strata for which size = 0 is interpreted as "no sampling".
As function argument, size is interpreted as the largest sample size without replacement that can be requested,
being bounded by the thinnest stratum with more than one row. The presence of size in call alters
the proportionality since each stratum - except one-row strata - contributes equally to the output size which is
the number of strata times the size value plus the number of one-row strata.
thresh. Automatic switch that modifies stratum sample size calculation method based on the extreme stratum
thickness values, stratification depth and total data rows. Internally, it searches for the formula that finds
at least one sample size accommodating the thinnest stratum with more than one row. Messages are displayed at runtime
although, in most cases the condition is satisfyed at first iteration. When thresh >= nrow(data), each stratum
is sampled proportional with the ratio between thinnest and thickest strata, which may lead to a relatively small size
output. All other thresh values compromise slightly between output size and proportionality (see Example 3).
Probabilistic Sampling
dis. The prob argument in base::sample cannot be used as required since the length of probability vector
varies with stratum thickness. Herein, stratum probability vectors are determined by the distribution specified in
argument dis which associates each stratum with a probability vector of thickness length. When args is
missing from call, dis uses the default argument values for respective distribution. An error is thrown when the
probability vector has insufficient number of non-zero values. See package stats, "Distributions" documentation.
NOTE: The random variate generators i.e. the r* version of distributions, generate vectors of absolute random deviate values which play the role of pseudo-probabilities conformant with the requirements listed in base::sample documentation.
Value
A proportional or non-proportional stratified sample (depending on whether size is absent or present
in call), either as row index or as sampled data, compounded from random or probability samples taken from each
stratum. Informative messages are displayed. Existing data row names are preserved in the output case in which, the sampled
data output gains the column named "rn".
See Also
Examples
if (interactive()) {
# 1. Row index for sampling
data(mtcars)
rowID = stratify(mtcars
, target = 'cyl'
, stratum = c('vs', 'am')
, seed = 314) # display information
print(rowID) # integer
# 2. Sampled data with extra-columns
smp = stratify(mtcars
, 'cyl'
, c('vs', 'am')
, seed = 314
, indx = FALSE
, ext = TRUE) # extra columns
print(smp)
identical(rowID, smp$row) # TRUE
# 3. Impact of "thresh" value on output size
sl = list()
thresholds = c(2, 4, 12, 32) # stratum thicknesses
for (t in seq(along=thresholds)) {
sl[[t]] = stratify(mtcars
, 'cyl'
, c('am', 'vs')
, thresh = thresholds[t]
, seed = 314
, indx = FALSE, ext = TRUE)
}
names(sl) = quote(thresholds)
print(sl) # stratified samples
# of various sizes
# 4. Probabilistic sampling
rowIDn = stratify(mtcars
, 'cyl'
, c('vs', 'am')
, seed = 314
, dis = pnorm # Normal distribution
, args = c(mean = 1, sd = 3)) # no first argument!
rowIDb = stratify(mtcars
, 'cyl'
, c('vs', 'am')
, seed = 314 # same seed
, dis = pbeta # Beta distribution
, args = c(shape1 = 1, shape2 = 3)) # no first argument!
# Same seed but changing the distribution changes the sample row index
identical(rowIDn, rowIDb) # FALSE
}
Tile And Write Tiled Data To Disk
Description
Splits long and wide data files in lists of disjoint tiles for further processing.
Usage
tileData(readpath, writepath = NULL, rows, splits, ...)
Arguments
readpath |
character length 1. Full path to the source file |
writepath |
character length 1. Full path to the destination file |
rows |
integer length 1. Number of rows in each subset. Internally, it determines the total number of subsets before the vertical split |
splits |
integer, length 1. Number of vertical data splits in each above subset. See splitV |
... |
extra arguments to splitH e.g. |
Details
Facilitates local operations on small size tiles by partitioning the data horizontally and vertically.
The list of tiles can be written to disk as "rds" file when a writepath destination is given. The written
data can then be read entirely or in subsets (see Example 2).
NOTE: This utility uses background processing. Check "Security Considerations" in callr package documentation.
Value
A listenv of "data.table" class tiles. When writepath is given, it produces
a "rds" file containing data tiles.
See Also
splitH, splitV, tileHot, readRDS
Examples
if (interactive()) {
# Make a 'csv' file
data(iris)
tmpf = tempfile(fileext = '.csv')
write.table(iris, tmpf , sep = ',', row.names = FALSE, quote = FALSE)
# 1. Tile data
a = tileData(tmpf, rows = 10, splits = 3) # 10x2 and 10x1 tiles
class(a) # listenv, environment
str(a) # nested list
tmpf1 = tempfile(fileext = '.rds') # new location
# 2. Write tiled data
tileData(tmpf, tmpf1, rows = 10, splits = 3)
a = readRDS(tmpf1)[[1]] # partial read from new location
print(a) # list component
unlink(tmpf)
unlink(tmpf1)
}
One-hot Encoder Of Tiled Data
Description
One-hot encodes tiled data.
Usage
tileHot(readpath, rows, splits, omc = "dgCMatrix", ...)
Arguments
readpath |
character, length 1. Path to source data that is readable with data.table::fread |
rows |
integer length 1. Number of rows in each data subset. Internally, it determines the total number of subsets before the vertical split |
splits |
integer, length 1. Number of vertical data splits in each subset, see splitV. Recommended for
very wide data frames. When |
omc |
character length 1. Output matrix class. Default, "dgCMatrix". Other option: "matrix" |
... |
reserved for splitH function arguments, such as |
Details
This utility reads the data in disjoint subsets, tiles them and then one-hot encodes each tile. Encoded
tiles are returned as nested list of matrices, as a single matrix, as data frame or as a two-component data frame
and sparse matrix list, decided through combinations of dropcols, omc and orn values.
NOTE 1: traceability is assured by assembling the data as character names and values from columns marked for encoding. As side effect, at run time the encoding is reported as being applied to "integer(ish)" values only with no loss in accuracy. Empty source data columns gain the "NA" suffix and become single-column, single-valued matrices.
NOTE 2: this utility implements background, processing. Check "Security Considerations" in callr package documentation.
Value
When
orn = FALSE, an unnamed listenv of sparse matrices. Recommended for very large source data files. Before proceeding with list output, read NOTE 2 in getEV documentation. See Examples 1 and 2.When
orn = TRUE, a matrix.
NOTE 3: In this case, row and column binding operations were avoided to prevent situations described in NOTE 2, getEV documentation. As result, the output matrix is gradually populated instead of being gradually expanded.
While orn = TRUE and dropcols != NULL:
When
omc = 'matrix', a data.table containing encoded, as well as unencoded, dropped columns placed in the leftmost positions.When
omc = 'dgCMatrix', a two-component listenv: a data table containing dropped, unencoded columns and a sparse matrix containing the encoded columns. The row order in both components is identical. See Examples below, and Example 2 in getEV documentation.
NOTE 4: In all above cases, specific encoded variables can be obtained with getEV extractor. When orn = TRUE,
oneHot decoded variables extracted from matrix outputs return named vectors having row numbers as names.
See Also
splitH, splitV, oneHot, listenv, Matrix
Examples
if (interactive()) {
# 1. Shuffled data
tempf = tempfile(fileext = '.csv')
data(iris)
iris22 = iris[{ set.seed(327); sample.int(150) },] # shuffled iris data
rownames(iris22) <- NULL # remove shuffled row names
write.table(iris22, tempf, sep = ',', row.names = FALSE, quote = FALSE)
# 1.1 Output as List
# In most cases, list output requires shuffled data!
A = tileHot(readpath = tempf
, rows = 14, splits = 3, print = FALSE) # encoded data tiles
print(A) # a listenv
print(A[[1]]) # a snapshot
# 1.2 Retrieve iris22 data from encoded list output
X = sapply(names(iris22), \(n) getEV(A, n)) # extract all encoded columns
Y = lapply(
lapply(X, oneHot, decode)
, unname) # decoded columns are named vectors!
d = as.data.frame(Y)
identical(iris22, d) # TRUE
unlink(tempf)
# 2. Unshuffled data
# Make unshuffled data 'csv' file
tempf = tempfile(fileext = '.csv')
write.table(iris, tempf, sep = ',', row.names = FALSE, quote = FALSE)
# 2.1 Output as list
# List output fails low cardinality variables on unshuffled data.
E = tileHot(readpath = tempf
, rows = 14, splits = 3, print = FALSE) # same as above
# 2.2 Retrieve iris data from encoded list output
V = sapply(names(iris), \(n) getEV(E, n)) # warning
W = lapply(
lapply(V, oneHot, decode)
, unname) # decoded columns are named vectors!
dd = as.data.frame(W)
identical(iris, dd) # FALSE
all.equal(iris, dd) # low cardinality "Species"
# 2.3 Output as matrix
# Matrix output handles low cardinality variables. No data shuffling required.
m = tileHot(readpath = tempf # low cardinality "Species"
, rows = 14
, splits = 3
, orn = TRUE, # needed for matrix output
, print = FALSE)
print(m) # 150x126 sparse matrix
# 2.4 Retrieve iris data from encoded matrix output
P = sapply(names(iris), \(n) getEV(m, n)) # extract encoded columns
Q = lapply(
lapply(P, oneHot, decode)
, unname) # decoded columns are named vectors!
R = as.data.frame(Q)
identical(iris, R) # TRUE
# 2.5 Output as "data.table" class
D = tileHot(readpath = tempf
, rows = 14
, splits = 3
, omc = 'matrix' # encoded dense matrix
, dropcols = c('Petal.Width', 'Petal.Length') # unencoded columns
, orn = TRUE # needed for matrix output
, print = FALSE)
print(head(D, 10)) # a "data.table" class
dim(D) # 150x63
# 2.6 Output as a 2-component list
Dl = tileHot(readpath = tempf
, rows = 14
, splits = 3
, omc = 'dgCMatrix' # the default class
, dropcols = c('Petal.Width', 'Petal.Length') # unencoded columns
, orn = TRUE # needed for matrix output
, print = FALSE)
print(Dl) # 2-component listenv
print(Dl[[1]]) # unencoded columns
print(Dl[[2]]) # encoded sparse matrix
# iris data can be retrieved from the Dl list in similar fashion described above
unlink(tempf)
}